KEGG   Homo sapiens (human): 54657Help
Entry
54657             CDS       T01001                                 

Gene name
UGT1A4, HUG-BR2, UDPGT, UDPGT_1-4, UGT-1D, UGT1-04, UGT1.4, UGT1D
Definition
UDP glucuronosyltransferase 1 family, polypeptide A4 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54657 (UGT1A4)
   00053 Ascorbate and aldarate metabolism
    54657 (UGT1A4)
   00500 Starch and sucrose metabolism
    54657 (UGT1A4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    54657 (UGT1A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54657 (UGT1A4)
   00860 Porphyrin and chlorophyll metabolism
    54657 (UGT1A4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54657 (UGT1A4)
   00982 Drug metabolism - cytochrome P450
    54657 (UGT1A4)
   00983 Drug metabolism - other enzymes
    54657 (UGT1A4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    54657 (UGT1A4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54657 (UGT1A4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54657 (UGT1A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 534 aa AA seqDB search
MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVV
LTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNV
SLALHRCCVELLHNEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDL
DFKGTQCPNPSSYIPKLLTTNSDHMTFLQRVKNMLYPLALSYICHTFSAPYASLASELFQ
REVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccagaggactccaggttcccctgccgcggctggccacaggactgctgctcctcctc
agtgtccagccctgggctgagagtggaaaggtgttggtggtgcccactgatggcagcccc
tggctcagcatgcgggaggccttgcgggagctccatgccagaggccaccaggcggtggtc
ctcaccccagaggtgaatatgcacatcaaagaagagaaatttttcaccctgacagcctat
gctgttccatggacccagaaggaatttgatcgcgttacgctgggctacactcaagggttc
tttgaaacagaacatcttctgaagagatattctagaagtatggcaattatgaacaatgta
tctttggcccttcataggtgttgtgtggagctactgcataatgaggccctgatcaggcac
ctgaatgctacttcctttgatgtggttttaacagaccccgttaacctctgtggggcggtg
ctggctaagtacctgtcgattcctgctgtgtttttttggaggtacattccatgtgactta
gactttaagggcacacagtgtccaaatccttcctcctatattcctaagttactaacgacc
aattcagaccacatgacattcctgcaaagggtcaagaacatgctctaccctctggccctg
tcctacatttgccatactttttctgccccttatgcaagtcttgcctctgagctttttcag
agagaggtgtcagtggtggatcttgtcagctatgcatccgtgtggctgttccgaggggac
tttgtgatggactaccccaggccgatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacgggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system