KEGG   Homo sapiens (human): 5467Help
Entry
5467              CDS       T01001                                 

Gene name
PPARD, FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
Definition
(RefSeq) peroxisome proliferator activated receptor delta
  KO
K04504  
peroxisome proliferator-activated receptor delta
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Wnt signaling pathway
Pathways in cancer
Acute myeloid leukemia
Drug target
Indeglitazar: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    5467 (PPARD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    5467 (PPARD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5467 (PPARD)
   05221 Acute myeloid leukemia
    5467 (PPARD)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5467 (PPARD)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5467 (PPARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 441 aa AA seqDB search
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccacaggaggaagcccctgaggtccgggaagaggaggagaaagaggaagtg
gcagaggcagaaggagccccagagctcaatgggggaccacagcatgcacttccttccagc
agctacacagacctctcccggagctcctcgccaccctcactgctggaccaactgcagatg
ggctgtgacggggcctcatgcggcagcctcaacatggagtgccgggtgtgcggggacaag
gcatcgggcttccactacggtgttcatgcatgtgaggggtgcaagggcttcttccgtcgt
acgatccgcatgaagctggagtacgagaagtgtgagcgcagctgcaagattcagaagaag
aaccgcaacaagtgccagtactgccgcttccagaagtgcctggcactgggcatgtcacac
aacgctatccgttttggtcggatgccggaggctgagaagaggaagctggtggcagggctg
actgcaaacgaggggagccagtacaacccacaggtggccgacctgaaggccttctccaag
cacatctacaatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcagcatc
ctcaccggcaaagccagccacacggcgccctttgtgatccacgacatcgagacattgtgg
caggcagagaaggggctggtgtggaagcagttggtgaatggcctgcctccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacagtggagaccgtgcgggagctc
actgagttcgccaagagcatccccagcttcagcagcctcttcctcaacgaccaggttacc
cttctcaagtatggcgtgcacgaggccatcttcgccatgctggcctctatcgtcaacaag
gacgggctgctggtagccaacggcagtggctttgtcacccgtgagttcctgcgcagcctc
cgcaaacccttcagtgatatcattgagcctaagtttgaatttgctgtcaagttcaacgcc
ctggaacttgatgacagtgacctggccctattcattgcggccatcattctgtgtggagac
cggccaggcctcatgaacgttccacgggtggaggctatccaggacaccatcctgcgtgcc
ctcgaattccacctgcaggccaaccaccctgatgcccagtacctcttccccaagctgctg
cagaagatggctgacctgcggcaactggtcaccgagcacgcccagatgatgcagcggatc
aagaagaccgaaaccgagacctcgctgcaccctctgctccaggagatctacaaggacatg
tactaa

DBGET integrated database retrieval system