KEGG   Homo sapiens (human): 54714Help
Entry
54714             CDS       T01001                                 

Gene name
CNGB3, ACHM1, ACHM3, RMCH
Definition
cyclic nucleotide gated channel beta 3
Orthology
K04953  
cyclic nucleotide gated channel beta 3
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Disease
H00819  
Stargardt disease (STGD)
H00971  
Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    54714 (CNGB3)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   54714 (CNGB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q21.3
AA seq 809 aa AA seqDB search
MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPV
TSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLYLLWLLLVTLAYNWNCCFIPLRL
VFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSNELRKHYRTSTKF
QLDVASIIPFDICYLFFGFNPMFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGYL
LFILHINACVYYWASNYEGIGTTRWVYDGEGNEYLRCYYWAVRTLITIGGLPEPQTLFEI
VFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVR
TWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRL
KSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGG
GNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPRK
DLALLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQ
KENEDKQKENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTS
RQSLIISMAPSAEGGEEVLTIEVKEKAKQ
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcgctgacaaaagtcaacaaggtgaagcctataggagagaacaatgagaat
gaacaaagttctcgtcggaatgaagaaggctctcacccaagtaatcagtctcagcaaacc
acagcacaggaagaaaacaaaggtgaagagaaatctctcaaaaccaagtcaactccagtc
acgtctgaagagccacacaccaacatacaagacaaactctccaagaaaaattcctctgga
gatctgaccacaaaccctgaccctcaaaatgcagcagaaccaactggaacagtgccagag
cagaaggaaatggaccccgggaaagaaggtccaaacagcccacaaaacaaaccgcctgca
gctcctgttataaatgagtatgccgatgcccagctacacaacctggtgaaaagaatgcgt
caaagaacagccctctacaagaaaaagttggtagagggagatctctcctcacccgaagcc
agcccacaaactgcaaagcccacggctgtaccaccagtaaaagaaagcgatgataagcca
acagaacattactacaggctgttgtggttcaaagtcaaaaagatgcctttaacagagtac
ttaaagcgaattaaacttccaaacagcatagattcatacacagatcgactctatctcctg
tggctcttgcttgtcactcttgcctataactggaactgctgttttataccactgcgcctc
gtcttcccatatcaaaccgcagacaacatacactactggcttattgcggacatcatatgt
gatatcatctacctttatgatatgctatttatccagcccagactccagtttgtaagagga
ggagacataatagtggattcaaatgagctaaggaaacactacaggacttctacaaaattt
cagttggatgtcgcatcaataataccatttgatatttgctacctcttctttgggtttaat
ccaatgtttagagcaaataggatgttaaagtacacttcattttttgaatttaatcatcac
ctagagtctataatggacaaagcatatatctacagagttattcgaacaactggatacttg
ctgtttattctgcacattaatgcctgtgtttattactgggcttcaaactatgaaggaatt
ggcactactagatgggtgtatgatggggaaggaaacgagtatctgagatgttattattgg
gcagttcgaactttaattaccattggtggccttccagaaccacaaactttatttgaaatt
gtttttcaactcttgaattttttttctggagtttttgtgttctccagtttaattggtcag
atgagagatgtgattggagcagctacagccaatcagaactacttccgcgcctgcatggat
gacaccattgcctacatgaacaattactccattcctaaacttgtgcaaaagcgagttcgg
acttggtatgaatatacatgggactctcaaagaatgctagatgagtctgatttgcttaag
accctaccaactacggtccagttagccctcgccattgatgtgaacttcagcatcatcagc
aaagtcgacttgttcaagggttgtgatacacagatgatttatgacatgttgctaagattg
aaatccgttctctatttgcctggtgactttgtctgcaaaaagggagaaattggcaaggaa
atgtatatcatcaagcatggagaagtccaagttcttggaggccctgatggtactaaagtt
ctggttactctgaaagctgggtcggtgtttggagaaatcagccttctagcagcaggagga
ggaaaccgtcgaactgccaatgtggtggcccacgggtttgccaatcttttaactctagac
aaaaagaccctccaagaaattctagtgcattatccagattctgaaaggatcctcatgaag
aaagccagagtgcttttaaagcagaaggctaagaccgcagaagcaacccctccaagaaaa
gatcttgccctcctcttcccaccgaaagaagagacacccaaactgtttaaaactctccta
ggaggcacaggaaaagcaagtcttgcaagactactcaaattgaagcgagagcaagcagct
cagaagaaagaaaattctgaaggaggagaggaagaaggaaaagaaaatgaagataaacaa
aaagaaaatgaagataaacaaaaagaaaatgaagataaaggaaaagaaaatgaagataaa
gataaaggaagagagccagaagagaagccactggacagacctgaatgtacagcaagtcct
attgcagtggaggaagaaccccactcagttagaaggacagttttacccagagggacttct
cgtcaatcactcattatcagcatggctccttctgctgagggcggagaagaggttcttact
attgaagtcaaagaaaaggctaagcaataa

DBGET integrated database retrieval system