KEGG   Homo sapiens (human): 54715Help
Entry
54715             CDS       T01001                                 

Gene name
RBFOX1, 2BP1, A2BP1, FOX-1, FOX1, HRNBP1
Definition
(RefSeq) RNA binding protein, fox-1 homolog 1
  KO
K14946  
RNA binding protein fox-1
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    54715 (RBFOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 397 aa AA seqDB search
MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPE
HTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLH
VSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTV
VEGRKIEVNNATARVMTNKKTVNPYTNGWKLNPVVGAVYSPEFYAGTVLLCQANQEGSSM
YSAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRGRTVYNTFRAAAPPPPIPAYGGVVY
QDGFYGADIYGGYAAYRYAQPTPATAAAYSDSYGRVYAADPYHHALAPAPTYGVGAMNAF
APLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFAPY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtgaaagagagcagctaaggggtaatcaggaagcagccgctgcccctgacaca
atggctcagccttacgcttcggcccagtttgctcccccgcagaacggtatccccgcggaa
tacacggcccctcatccccaccccgcgccagagtacacaggccagaccacggttcccgag
cacacattaaacctgtaccctcccgcccagacgcactccgagcagagcccggcggacacg
agcgctcagaccgtctctggcaccgccacacagacagatgacgcagcaccgacggatggc
cagccccagacacaaccttctgaaaacacggaaaacaagtctcagcccaagcggctgcat
gtctccaatatccccttcaggttccgggatccggacctcagacaaatgtttggtcaattt
ggtaaaatcttagatgttgaaattatttttaatgagcgaggctcaaagggatttggtttc
gtaactttcgaaaatagtgccgatgcggacagggcgagggagaaattacacggcaccgtg
gtagagggccgtaaaatcgaggtaaataatgccacagcacgtgtaatgacaaataaaaag
accgtcaacccttatacaaatggctggaaattgaatccagttgtgggtgcagtctacagt
cccgaattctatgcaggcacggtcctgttgtgccaggccaaccaggagggatcttccatg
tacagtgcccccagttcacttgtatatacttctgcaatgccaggcttcccgtatccagca
gccaccgccgcggccgcctaccgaggggcgcacctgcgaggccgcggtcgcaccgtgtac
aacaccttcagggccgcggcgcccccgcccccgatcccggcctacggcggtgttgtttac
caggatggattttatggtgcagacatttatggtggttatgctgcataccgctacgcccag
cctacccctgccactgccgctgcctacagtgacagttacggacgagtttatgctgccgac
ccctaccaccacgcacttgctccagcccccacctacggcgttggtgccatgaatgctttt
gcacctttgactgatgccaagactaggagccatgctgatgatgtgggtctcgttctttct
tcattgcaggctagtatataccgagggggatacaaccgttttgctccatactaa

DBGET integrated database retrieval system