KEGG   Homo sapiens (human): 54732Help
Entry
54732             CDS       T01001                                 

Gene name
TMED9, GMP25, HSGP25L2G, p25
Definition
transmembrane emp24 protein transport domain containing 9
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 235 aa AA seqDB search
MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMV
IGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQI
CLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQK
EQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggagctgggcgtgctgctcgtccggccccggcccggaaccgggctgggtaga
gtgatgcggaccctcctgctggtgctgtggctggcgacgcgcggaagcgcgctctacttt
cacatcggagagacggagaagaagtgctttattgaggagatcccggacgagaccatggtc
ataggaaactaccggacgcagctgtatgacaagcagcgggaggagtaccagccggccacc
ccggggcttggcatgtttgtggaggtgaaggacccagaggacaaggtcatcctggcccgg
cagtatggctccgagggcaggttcactttcacttcccatacccctggtgagcaccagatc
tgtcttcactccaattccaccaagttctccctctttgctggaggcatgctgagagttcac
ctggacatccaggtaggtgaacatgccaatgactatgcagaaattgctgctaaagacaag
ttgagtgagttgcagctacgagtgcgacagctggtggaacaagtggagcagatccagaaa
gagcagaactaccagcggtggcgagaggagcgcttccggcagaccagtgagagcaccaac
cagcgggtgctgtggtggtccattctgcagaccctcatcctcgtggccatcggtgtctgg
cagatgcggcacctcaagagcttctttgaagccaagaagcttgtgtag

DBGET integrated database retrieval system