KEGG   Homo sapiens (human): 54732Help
Entry
54732             CDS       T01001                                 

Gene name
TMED9, GMP25, HSGP25L2G, p24a2, p24alpha2, p25
Definition
(RefSeq) transmembrane p24 trafficking protein 9
  KO
K20346  
p24 family protein alpha
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    54732 (TMED9)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   54732 (TMED9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9BVK6(Tdark)
UniProt: 
Position
5q35.3
AA seq 235 aa AA seqDB search
MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMV
IGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQI
CLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQK
EQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggagctgggcgtgctgctcgtccggccccggcccggaaccgggctgggtaga
gtgatgcggaccctcctgctggtgctgtggctggcgacgcgcggaagcgcgctctacttt
cacatcggagagacggagaagaagtgctttattgaggagatcccggacgagaccatggtc
ataggaaactaccggacgcagctgtatgacaagcagcgggaggagtaccagccggccacc
ccggggcttggcatgtttgtggaggtgaaggacccagaggacaaggtcatcctggcccgg
cagtatggctccgagggcaggttcactttcacttcccatacccctggtgagcaccagatc
tgtcttcactccaattccaccaagttctccctctttgctggaggcatgctgagagttcac
ctggacatccaggtaggtgaacatgccaatgactatgcagaaattgctgctaaagacaag
ttgagtgagttgcagctacgagtgcgacagctggtggaacaagtggagcagatccagaaa
gagcagaactaccagcggtggcgagaggagcgcttccggcagaccagtgagagcaccaac
cagcgggtgctgtggtggtccattctgcagaccctcatcctcgtggccatcggtgtctgg
cagatgcggcacctcaagagcttctttgaagccaagaagcttgtgtag

DBGET integrated database retrieval system