KEGG   Homo sapiens (human): 5476Help
Entry
5476              CDS       T01001                                 

Gene name
CTSA, GLB2, GSL, NGBE, PPCA, PPGB
Definition
cathepsin A (EC:3.4.16.5)
Orthology
K13289  
cathepsin A (carboxypeptidase C) [EC:3.4.16.5]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Renin-angiotensin system
Disease
H00276  
Galactosialidosis
H00422  
Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    5476 (CTSA)
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    5476 (CTSA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.5  carboxypeptidase C
     5476 (CTSA)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S10
   5476 (CTSA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5476 (CTSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.1
AA seq 498 aa AA seqDB search
MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLA
KQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFL
VQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFR
LFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFA
YYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCA
GGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLN
NPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMA
CNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTD
KPLAAFTMFSRFLNKQPY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacttccagtccccgggcgcctcctggagagcaaggacgcgggggagcagagatgatc
cgagccgcgccgccgccgctgttcctgctgctgctgctgctgctgctgctagtgtcctgg
gcgtcccgaggcgaggcagcccccgaccaggacgagatccagcgcctccccgggctggcc
aagcagccgtctttccgccagtactccggctacctcaaaggctccggctccaagcacctc
cactactggtttgtggagtcccagaaggatcccgagaacagccctgtggtgctttggctc
aatgggggtcccggctgcagctcactagatgggctcctcacagagcatggccccttcctg
gtccagccagatggtgtcaccctggagtacaacccctattcttggaatctgattgccaat
gtgttatacctggagtccccagctggggtgggcttctcctactccgatgacaagttttat
gcaactaatgacactgaggtcgcccagagcaattttgaggcccttcaagatttcttccgc
ctctttccggagtacaagaacaacaaacttttcctgaccggggagagctatgctggcatc
tacatccccaccctggccgtgctggtcatgcaggatcccagcatgaaccttcaggggctg
gctgtgggcaatggactctcctcctatgagcagaatgacaactccctggtctactttgcc
tactaccatggccttctggggaacaggctttggtcttctctccagacccactgctgctct
caaaacaagtgtaacttctatgacaacaaagacctggaatgcgtgaccaatcttcaggaa
gtggcccgcatcgtgggcaactctggcctcaacatctacaatctctatgccccgtgtgct
ggaggggtgcccagccattttaggtatgagaaggacactgttgtggtccaggatttgggc
aacatcttcactcgcctgccactcaagcggatgtggcatcaggcactgctgcgctcaggg
gataaagtgcgcatggaccccccctgcaccaacacaacagctgcttccacctacctcaac
aacccgtacgtgcggaaggccctcaacatcccggagcagctgccacaatgggacatgtgc
aactttctggtaaacttacagtaccgccgtctctaccgaagcatgaactcccagtatctg
aagctgcttagctcacagaaataccagatcctattatataatggagatgtagacatggcc
tgcaatttcatgggggatgagtggtttgtggattccctcaaccagaagatggaggtgcag
cgccggccctggttagtgaagtacggggacagcggggagcagattgccggcttcgtgaag
gagttctcccacatcgcctttctcacgatcaagggcgccggccacatggttcccaccgac
aagcccctcgctgccttcaccatgttctcccgcttcctgaacaagcagccatactga

DBGET integrated database retrieval system