KEGG   Homo sapiens (human): 54769Help
Entry
54769             CDS       T01001                                 

Gene name
DIRAS2, Di-Ras2
Definition
(RefSeq) DIRAS family GTPase 2
  KO
K07841  
DIRAS family, GTP-binding Ras-like 2
Organism
hsa  Homo sapiens (human)
Brite
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Di-Ras [OT]
    54769 (DIRAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.2
AA seq 199 aa AA seqDB search
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVG
NKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
KKSKQQKRKEKLKGKCVIM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcagagtaacgattaccgggtggccgtgtttggggctggcggtgttggcaag
agctccctggtgttgaggtttgtgaaaggcacattccgggagagctacatcccgacggtg
gaagacacctaccggcaagtgatcagctgtgacaagagcatatgcacattgcagatcacc
gacacgacggggagccaccagttcccggccatgcagcggctgtccatctccaaagggcac
gccttcatcctggtgtactccattaccagccgacagtccttggaggagctcaagcccatc
tacgaacaaatctgcgagatcaaaggggacgtggagagcatccccatcatgctggtgggg
aacaagtgtgatgagagccccagccgcgaggtgcagagcagcgaggcggaggccttggcc
cgcacatggaagtgtgccttcatggagacctcagccaagctcaaccataacgtgaaggag
cttttccaggagctgctcaacctggagaagcgcaggaccgtgagtctccagatcgacggg
aaaaagagcaagcagcagaaaaggaaagagaagctcaaaggcaagtgcgtgatcatgtga

DBGET integrated database retrieval system