KEGG   Homo sapiens (human): 5478Help
Entry
5478              CDS       T01001                                 

Gene name
PPIA, CYPA, CYPH, HEL-S-69p
Definition
(RefSeq) peptidylprolyl isomerase A (EC:5.2.1.8)
  KO
K03767  
peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5478 (PPIA)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5478 (PPIA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5478 (PPIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13
AA seq 165 aa AA seqDB search
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccccaccgtgttcttcgacattgccgtcgacggcgagcccttgggccgcgtc
tcctttgagctgtttgcagacaaggtcccaaagacagcagaaaattttcgtgctctgagc
actggagagaaaggatttggttataagggttcctgctttcacagaattattccagggttt
atgtgtcagggtggtgacttcacacgccataatggcactggtggcaagtccatctatggg
gagaaatttgaagatgagaacttcatcctaaagcatacgggtcctggcatcttgtccatg
gcaaatgctggacccaacacaaatggttcccagtttttcatctgcactgccaagactgag
tggttggatggcaagcatgtggtgtttggcaaagtgaaagaaggcatgaatattgtggag
gccatggagcgctttgggtccaggaatggcaagaccagcaagaagatcaccattgctgac
tgtggacaactcgaataa

DBGET integrated database retrieval system