KEGG   Homo sapiens (human): 54788Help
Entry
54788             CDS       T01001                                 

Gene name
DNAJB12, DJ10
Definition
DnaJ (Hsp40) homolog, subfamily B, member 12
Orthology
K09518  
DnaJ homolog subfamily B member 12
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54788 (DNAJB12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.1
AA seq 409 aa AA seqDB search
MSSLRARLPATRRRVAQPFARPASPSLVPRSGSAMESNKDEAERCISIALKAIQSNQPDR
ALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTDAPSANGEA
GGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPG
ATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNM
FFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLM
VSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLR
NNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactccgcgcccggctgcccgcgacgcgccggcgggtggcgcagcccttcgct
cgcccggcctccccctccctggttccgcgttctggttccgccatggaatccaacaaggat
gaagctgagcgctgtatcagcatcgccctcaaggccatccagagcaaccagcccgaccgg
gcgctccgcttcctggagaaggcacagcggctgtatccgacgccgcgagttcgcgccctg
attgagtccctcaaccagaaaccacagactgccggtgaccaacccccacccacagacaca
acccatgccacccacaggaaagcaggtgggaccgatgccccctcggccaacggtgaagct
ggaggagagagcaccaaaggctacactgcagaacaggttgcagctgtgaaaagggtcaag
caatgtaaagattactatgagatcctgggggtgagcagaggggcctcggatgaggacctg
aagaaggcctaccgcagactggccctcaaattccacccagacaagaaccacgcacctggt
gccactgaagccttcaaagccattggcacagcatatgcggtactcagcaacccggagaag
aggaagcagtatgaccagttcggcgatgacaagagccaggcggcccggcacggccatggg
catggggatttccaccgtggctttgaggccgacatctcccctgaagacctcttcaacatg
ttctttggcggcggcttcccttctagtaacgtccacgtctacagcaacggccgcatgcgc
tatacctaccagcaaaggcaggaccgcagggacaaccagggtgatggcgggctaggggtg
tttgtgcagctgatgcctatcctcatcctgattctcgtgtcagctctcagccagctcatg
gtctccagtccaccctacagtctgagtccaagaccgtccgtgggccacatccacaggcga
gtcactgaccacctgggtgtcgtctactatgtgggagacactttctccgaagagtacaca
ggctccagcctcaaaacagtcgagcggaatgtggaagatgattatatcgccaacctccgg
aacaactgctggaaggagaagcagcagaaggaaggcttgctgtaccgggcacgctacttt
ggcgacacagatatgtaccacagagcacagaagatgggcacccccagctgcagccgactg
tcagaggtgcaggcctccctgcatggatag

DBGET integrated database retrieval system