KEGG   Homo sapiens (human): 5479Help
Entry
5479              CDS       T01001                                 

Gene name
PPIB, CYP-S1, CYPB, HEL-S-39, OI9, SCYLP
Definition
(RefSeq) peptidylprolyl isomerase B (EC:5.2.1.8)
  KO
K03768  
peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Disease
H00506  
Osteogenesis imperfecta
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5479 (PPIB)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5479 (PPIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21-q22
AA seq 216 aa AA seqDB search
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctctccgaacgcaacatgaaggtgctccttgccgccgccctcatcgcgggg
tccgtcttcttcctgctgctgccgggaccttctgcggccgatgagaagaagaaggggccc
aaagtcaccgtcaaggtgtattttgacctacgaattggagatgaagatgtaggccgggtg
atctttggtctcttcggaaagactgttccaaaaacagtggataattttgtggccttagct
acaggagagaaaggatttggctacaaaaacagcaaattccatcgtgtaatcaaggacttc
atgatccagggcggagacttcaccaggggagatggcacaggaggaaagagcatctacggt
gagcgcttccccgatgagaacttcaaactgaagcactacgggcctggctgggtgagcatg
gccaacgcaggcaaagacaccaacggctcccagttcttcatcacgacagtcaagacagcc
tggctagatggcaagcatgtggtgtttggcaaagttctagagggcatggaggtggtgcgg
aaggtggagagcaccaagacagacagccgggataaacccctgaaggatgtgatcatcgca
gactgcggcaagatcgaggtggagaagccctttgccatcgccaaggagtag

DBGET integrated database retrieval system