KEGG   Homo sapiens (human): 54795Help
Entry
54795             CDS       T01001                                 

Gene name
TRPM4, LTrpC4, PFHB1B, TRPM4B, hTRPM4
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 4
  KO
K04979  
transient receptor potential cation channel subfamily M member 4
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Disease
H01263  
Progressive cardiac conduction defect (PCCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    54795 (TRPM4)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   54795 (TRPM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 1214 aa AA seqDB search
MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTV
WDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVS
VLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGG
TKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTH
GCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLL
VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKEL
LTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQA
SHSAGTKAPALKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLL
SDKATSPLSLDAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA
RLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWGDATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCPPLIYTRLITFRKSEEEPTRE
ELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLRRWFHFWGAPV
TIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM
VFTVRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFP
SILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLV
VLLLVIFLLVANILLVNLLIAMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFI
VISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDK
RESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLP
PGGPPPPDLPGSKD
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgccggagaaggagcagagctggatccccaagatcttcaagaagaagacctgc
acgacgttcatagttgactccacagatccgggagggaccttgtgccagtgtgggcgcccc
cggaccgcccaccccgcagtggccatggaggatgccttcggggcagccgtggtgaccgtg
tgggacagcgatgcacacaccacggagaagcccaccgatgcctacggagagctggacttc
acgggggccggccgcaagcacagcaatttcctccggctctctgaccgaacggatccagct
gcagtttatagtctggtcacacgcacatggggcttccgtgccccgaacctggtggtgtca
gtgctggggggatcggggggccccgtcctccagacctggctgcaggacctgctgcgtcgt
gggctggtgcgggctgcccagagcacaggagcctggattgtcactgggggtctgcacacg
ggcatcggccggcatgttggtgtggctgtacgggaccatcagatggccagcactgggggc
accaaggtggtggccatgggtgtggccccctggggtgtggtccggaatagagacaccctc
atcaaccccaagggctcgttccctgcgaggtaccggtggcgcggtgacccggaggacggg
gtccagtttcccctggactacaactactcggccttcttcctggtggacgacggcacacac
ggctgcctggggggcgagaaccgcttccgcttgcgcctggagtcctacatctcacagcag
aagacgggcgtgggagggactggaattgacatccctgtcctgctcctcctgattgatggt
gatgagaagatgttgacgcgaatagagaacgccacccaggctcagctcccatgtctcctc
gtggctggctcagggggagctgcggactgcctggcggagaccctggaagacactctggcc
ccagggagtgggggagccaggcaaggcgaagcccgagatcgaatcaggcgtttctttccc
aaaggggaccttgaggtcctgcaggcccaggtggagaggattatgacccggaaggagctc
ctgacagtctattcttctgaggatgggtctgaggaattcgagaccatagttttgaaggcc
cttgtgaaggcctgtgggagctcggaggcctcagcctacctggatgagctgcgtttggct
gtggcttggaaccgcgtggacattgcccagagtgaactctttcggggggacatccaatgg
cggtccttccatctcgaagcttccctcatggacgccctgctgaatgaccggcctgagttc
gtgcgcttgctcatttcccacggcctcagcctgggccacttcctgaccccgatgcgcctg
gcccaactctacagcgcggcgccctccaactcgctcatccgcaaccttttggaccaggcg
tcccacagcgcaggcaccaaagccccagccctaaaagggggagctgcggagctccggccc
cctgacgtggggcatgtgctgaggatgctgctggggaagatgtgcgcgccgaggtacccc
tccgggggcgcctgggaccctcacccaggccagggcttcggggagagcatgtatctgctc
tcggacaaggccacctcgccgctctcgctggatgctggcctcgggcaggccccctggagc
gacctgcttctttgggcactgttgctgaacagggcacagatggccatgtacttctgggag
atgggttccaatgcagtttcctcagctcttggggcctgtttgctgctccgggtgatggca
cgcctggagcctgacgctgaggaggcagcacggaggaaagacctggcgttcaagtttgag
gggatgggcgttgacctctttggcgagtgctatcgcagcagtgaggtgagggctgcccgc
ctcctcctccgtcgctgcccgctctggggggatgccacttgcctccagctggccatgcaa
gctgacgcccgtgccttctttgcccaggatggggtacagtctctgctgacacagaagtgg
tggggagatatggccagcactacacccatctgggccctggttctcgccttcttttgccct
ccactcatctacacccgcctcatcaccttcaggaaatcagaagaggagcccacacgggag
gagctagagtttgacatggatagtgtcattaatggggaagggcctgtcgggacggcggac
ccagccgagaagacgccgctgggggtcccgcgccagtcgggccgtccgggttgctgcggg
ggccgctgcggggggcgccggtgcctacgccgctggttccacttctggggcgcgccggtg
accatcttcatgggcaacgtggtcagctacctgctgttcctgctgcttttctcgcgggtg
ctgctcgtggatttccagccggcgccgcccggctccctggagctgctgctctatttctgg
gctttcacgctgctgtgcgaggaactgcgccagggcctgagcggaggcgggggcagcctc
gccagcgggggccccgggcctggccatgcctcactgagccagcgcctgcgcctctacctc
gccgacagctggaaccagtgcgacctagtggctctcacctgcttcctcctgggcgtgggc
tgccggctgaccccgggtttgtaccacctgggccgcactgtcctctgcatcgacttcatg
gttttcacggtgcggctgcttcacatcttcacggtcaacaaacagctggggcccaagatc
gtcatcgtgagcaagatgatgaaggacgtgttcttcttcctcttcttcctcggcgtgtgg
ctggtagcctatggcgtggccacggaggggctcctgaggccacgggacagtgacttccca
agtatcctgcgccgcgtcttctaccgtccctacctgcagatcttcgggcagattccccag
gaggacatggacgtggccctcatggagcacagcaactgctcgtcggagcccggcttctgg
gcacaccctcctggggcccaggcgggcacctgcgtctcccagtatgccaactggctggtg
gtgctgctcctcgtcatcttcctgctcgtggccaacatcctgctggtcaacttgctcatt
gccatgttcagttacacattcggcaaagtacagggcaacagcgatctctactggaaggcg
cagcgttaccgcctcatccgggaattccactctcggcccgcgctggccccgccctttatc
gtcatctcccacttgcgcctcctgctcaggcaattgtgcaggcgaccccggagcccccag
ccgtcctccccggccctcgagcatttccgggtttacctttctaaggaagccgagcggaag
ctgctaacgtgggaatcggtgcataaggagaactttctgctggcacgcgctagggacaag
cgggagagcgactccgagcgtctgaagcgcacgtcccagaaggtggacttggcactgaaa
cagctgggacacatccgcgagtacgaacagcgcctgaaagtgctggagcgggaggtccag
cagtgtagccgcgtcctggggtgggtggccgaggccctgagccgctctgccttgctgccc
ccaggtgggccgccaccccctgacctgcctgggtccaaagactga

DBGET integrated database retrieval system