KEGG   Homo sapiens (human): 54802Help
Entry
54802             CDS       T01001                                 

Gene name
TRIT1, IPT, MOD5
Definition
tRNA isopentenyltransferase 1 (EC:2.5.1.75)
Orthology
K00791  
tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.2
AA seq 467 aa AA seqDB search
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtggcggctgcacgagcagttcccgtgggcagtgggctcaggggcctgcaa
cggaccctacctcttgtagtgattctcggggccacgggcaccggcaaatccacgctggcg
ttgcagctaggccagcggctcggcggtgagatcgtcagcgctgactccatgcaggtctat
gaaggcctagacatcatcaccaacaaggtttctgcccaagagcagagaatctgccggcac
cacatgatcagctttgtggatcctcttgtgaccaattacacagtggtggacttcagaaat
agagcaactgctctgattgaagatatatttgcccgagacaaaattcctattgttgtggga
ggaaccaattattacattgaatctctgctctggaaagttcttgtcaataccaagccccag
gagatgggcactgagaaagtgattgaccgaaaagtggagcttgaaaaggaggatggtctt
gtacttcacaaacgcctaagccaggtggacccagaaatggctgccaagctgcatccacat
gacaaacgcaaagtggccaggagcttgcaagtttttgaagaaacaggaatctctcatagt
gaatttctccatcgtcaacatacggaagaaggtggtggtccccttggaggtcctctgaag
ttctctaacccttgcatcctttggcttcatgctgaccaggcagttctagatgagcgcttg
gataagagggtggatgacatgcttgctgctgggctcttggaggaactaagagattttcac
agacgctataatcagaagaatgtttcggaaaatagccaggactatcaacatggtatcttc
caatcaattggcttcaaggaatttcacgagtacctgatcactgagggaaaatgcacactg
gagactagtaaccagcttctaaagaaaggtattgaggctctgaaacaagtaactaagaga
tatgcccggaaacaaaaccgatgggttaaaaaccgttttttgagcagacctggtcccatt
gtcccccctgtctatggcttagaggtatctgatgtctcgaagtgggaagagtctgttctt
gaacctgctcttgaaatcgtgcaaagtttcatccagggccacaagcctacagccactcca
ataaagatgccatacaatgaagctgagaacaagagaagttatcacctgtgtgacctctgt
gatcgaatcatcattggggatcgcgaatgggcagcgcacataaaatccaaatcccacttg
aaccaactgaagaaaagaagaagattggactcagatgctgtcaacaccatagaaagtcag
agtgtttccccagaccataacaaagaacctaaagagaagggatccccagggcagaatgat
caagagctgaaatgcagcgtttaa

DBGET integrated database retrieval system