KEGG   Homo sapiens (human): 54802Help
Entry
54802             CDS       T01001                                 

Gene name
TRIT1, COXPD35, GRO1, IPPT, IPT, IPTase, MOD5, hGRO1
Definition
(RefSeq) tRNA isopentenyltransferase 1
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     54802 (TRIT1)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   54802 (TRIT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    54802 (TRIT1)
 Prokaryotic Type
    54802 (TRIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPPT AAA_33 IPT zf-C2H2_jaz AAA_28 AAA_18 AAA_16 AAA_22 Hpr_kinase_C AAA RNA_helicase Cytidylate_kin KTI12 AAA_25 IstB_IS21 ABC_tran zf-met CD99L2 PRK AAA_5 DUF87
Motif
Other DBs
NCBI-GeneID: 54802
NCBI-ProteinID: NP_060116
OMIM: 617840
HGNC: 20286
Ensembl: ENSG00000043514
Vega: OTTHUMG00000009245
Pharos: Q9H3H1(Tbio)
UniProt: Q9H3H1 Q3T7C7 Q53F11
Position
1p34.2
AA seq 467 aa AA seqDB search
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtggcggctgcacgagcagttcccgtgggcagtgggctcaggggcctgcaa
cggaccctacctcttgtagtgattctcggggccacgggcaccggcaaatccacgctggcg
ttgcagctaggccagcggctcggcggtgagatcgtcagcgctgactccatgcaggtctat
gaaggcctagacatcatcaccaacaaggtttctgcccaagagcagagaatctgccggcac
cacatgatcagctttgtggatcctcttgtgaccaattacacagtggtggacttcagaaat
agagcaactgctctgattgaagatatatttgcccgagacaaaattcctattgttgtggga
ggaaccaattattacattgaatctctgctctggaaagttcttgtcaataccaagccccag
gagatgggcactgagaaagtgattgaccgaaaagtggagcttgaaaaggaggatggtctt
gtacttcacaaacgcctaagccaggtggacccagaaatggctgccaagctgcatccacat
gacaaacgcaaagtggccaggagcttgcaagtttttgaagaaacaggaatctctcatagt
gaatttctccatcgtcaacatacggaagaaggtggtggtccccttggaggtcctctgaag
ttctctaacccttgcatcctttggcttcatgctgaccaggcagttctagatgagcgcttg
gataagagggtggatgacatgcttgctgctgggctcttggaggaactaagagattttcac
agacgctataatcagaagaatgtttcggaaaatagccaggactatcaacatggtatcttc
caatcaattggcttcaaggaatttcacgagtacctgatcactgagggaaaatgcacactg
gagactagtaaccagcttctaaagaaaggtattgaggctctgaaacaagtaactaagaga
tatgcccggaaacaaaaccgatgggttaaaaaccgttttttgagcagacctggtcccatt
gtcccccctgtctatggcttagaggtatctgatgtctcgaagtgggaagagtctgttctt
gaacctgctcttgaaatcgtgcaaagtttcatccagggccacaagcctacagccactcca
ataaagatgccatacaatgaagctgagaacaagagaagttatcacctgtgtgacctctgt
gatcgaatcatcattggggatcgcgaatgggcagcgcacataaaatccaaatcccacttg
aaccaactgaagaaaagaagaagattggactcagatgctgtcaacaccatagaaagtcag
agtgtttccccagaccataacaaagaacctaaagagaagggatccccagggcagaatgat
caagagctgaaatgcagcgtttaa

DBGET integrated database retrieval system