KEGG   Homo sapiens (human): 54802Help
Entry
54802             CDS       T01001                                 

Gene name
TRIT1, IPT, MOD5
Definition
tRNA isopentenyltransferase 1 (EC:2.5.1.75)
Orthology
K00791  
tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     54802 (TRIT1)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   54802 (TRIT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    54802 (TRIT1)
 Prokaryotic Type
    54802 (TRIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.2
AA seq 467 aa AA seqDB search
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgtggcggctgcacgagcagttcccgtgggcagtgggctcaggggcctgcaa
cggaccctacctcttgtagtgattctcggggccacgggcaccggcaaatccacgctggcg
ttgcagctaggccagcggctcggcggtgagatcgtcagcgctgactccatgcaggtctat
gaaggcctagacatcatcaccaacaaggtttctgcccaagagcagagaatctgccggcac
cacatgatcagctttgtggatcctcttgtgaccaattacacagtggtggacttcagaaat
agagcaactgctctgattgaagatatatttgcccgagacaaaattcctattgttgtggga
ggaaccaattattacattgaatctctgctctggaaagttcttgtcaataccaagccccag
gagatgggcactgagaaagtgattgaccgaaaagtggagcttgaaaaggaggatggtctt
gtacttcacaaacgcctaagccaggtggacccagaaatggctgccaagctgcatccacat
gacaaacgcaaagtggccaggagcttgcaagtttttgaagaaacaggaatctctcatagt
gaatttctccatcgtcaacatacggaagaaggtggtggtccccttggaggtcctctgaag
ttctctaacccttgcatcctttggcttcatgctgaccaggcagttctagatgagcgcttg
gataagagggtggatgacatgcttgctgctgggctcttggaggaactaagagattttcac
agacgctataatcagaagaatgtttcggaaaatagccaggactatcaacatggtatcttc
caatcaattggcttcaaggaatttcacgagtacctgatcactgagggaaaatgcacactg
gagactagtaaccagcttctaaagaaaggtattgaggctctgaaacaagtaactaagaga
tatgcccggaaacaaaaccgatgggttaaaaaccgttttttgagcagacctggtcccatt
gtcccccctgtctatggcttagaggtatctgatgtctcgaagtgggaagagtctgttctt
gaacctgctcttgaaatcgtgcaaagtttcatccagggccacaagcctacagccactcca
ataaagatgccatacaatgaagctgagaacaagagaagttatcacctgtgtgacctctgt
gatcgaatcatcattggggatcgcgaatgggcagcgcacataaaatccaaatcccacttg
aaccaactgaagaaaagaagaagattggactcagatgctgtcaacaccatagaaagtcag
agtgtttccccagaccataacaaagaacctaaagagaagggatccccagggcagaatgat
caagagctgaaatgcagcgtttaa

DBGET integrated database retrieval system