KEGG   Homo sapiens (human): 54808Help
Entry
54808             CDS       T01001                                 

Gene name
DYM, DMC, SMC
Definition
dymeclin
Organism
hsa  Homo sapiens (human)
Disease
H00757  
Dyggve-Melchior-Clausen disease and Smith-McCort dysplasia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 669 aa AA seqDB search
MGSNSSRIGDLPKNEYLKKLSGTESISENDPFWNQLLSFSFPAPTSSSELKLLEEATISV
CRSLVENNPRTGNLGALIKVFLSRTKELKLSAECQNHIFIWQTHNALFIICCLLKVFICQ
MSEEELQLHFTYEEKSPGNYSSDSEDLLEELLCCLMQLITDIPLLDITYEISVEAISTMV
VFLSCQLFHKEVLRQSISHKYLMRGPCLPYTSKLVKTLLYNFIRQEKPPPPGAHVFPQQS
DGGGLLYGLASGVATGLWTVFTLGGVGSKAAASPELSSPLANQSLLLLLVLANLTDASDA
PNPYRQAIMSFKNTQDSSPFPSSIPHAFQINFNSLYTALCEQQTSDQATLLLYTLLHQNS
NIRTYMLARTDMENLVLPILEILYHVEERNSHHVYMALIILLILTEDDGFNRSIHEVILK
NITWYSERVLTEISLGSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQY
AAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIRMMLEIIN
SCLTNSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRLLQAGAELSV
ERVLEIIKQGVVALPKDRLKKFPELKFKYVEEEQPEEFFIPYVWSLVYNSAVGLYWNPQD
IQLFTMDSD
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgaatagcagcagaatcggcgatcttcctaaaaatgagtacttgaaaaagtta
tcaggcacggaatctatctctgagaatgacccgttctggaatcagcttctctcattttct
ttccctgcaccaactagcagtagtgagttgaaactcttggaggaagcaaccatttcagtc
tgcaggtcattagttgaaaacaatcctcgaacaggaaatcttggtgcactaattaaggtc
ttcctttctagaaccaaagaactaaaactttcagcagaatgtcagaaccacatcttcatt
tggcagacacacaatgctttgtttattatttgctgtttgctgaaagtgttcatctgtcag
atgtcagaggaggaattacaacttcattttacttatgaagaaaaatctcctggcaattac
agttctgactcagaagatcttttggaagaattgctgtgctgtttgatgcagttgatcact
gatattccactcttagatattacatatgaaatatcagtagaagctatatcaacaatggtt
gttttcctttcctgccaactcttccacaaagaagttttgcgacagagcatcagccacaag
tatttgatgcgaggtccatgtcttccatacaccagcaaacttgtgaagaccttattatat
aactttatcagacaagaaaagccacctcctccaggggcccatgttttccctcagcagtcg
gatgggggaggactgctttatggacttgcatcaggagtagcaacaggactctggactgtc
ttcacactaggtggtgtgggcagcaaagcggctgcctctccagagctttcttcccctctg
gccaaccagagtctcctgcttctgctggtgttggccaatctgacagatgcctcagatgcg
ccaaacccctacagacaagccattatgtccttcaagaacacacaagatagcagtcctttc
ccctcatcaattccacatgccttccagatcaactttaatagtttgtacacagctctttgt
gaacagcagacatctgatcaagcaactctcctcttgtataccttgctccatcaaaatagt
aatattagaacatacatgttggctcgcacagatatggaaaatcttgttttaccaattctt
gagattctgtatcatgttgaagaaaggaattcacaccatgtgtatatggcccttataata
ttgttgatccttacggaagatgatggcttcaacagatccattcatgaagtgatactaaaa
aatattacttggtattcagaacgagttttaactgaaatctccttggggagtctcctgatc
ctggtggtaataagaaccattcaatacaacatgactaggacacgagacaagtaccttcac
acaaattgtttggcagctttagcaaatatgtcggcacagtttcgttctctccatcagtat
gctgcccagaggatcatcagtttattttctttgctgtctaaaaaacacaacaaagttctg
gaacaagccacacagtccttgagaggttcgctgagttctaatgatgttcctctaccagat
tatgcacaagacctaaatgtcattgaagaagtgattcgaatgatgttagagatcatcaac
tcctgcctgacaaattcccttcaccacaacccaaacttggtatacgccctgctttacaaa
cgcgatctctttgaacaatttcgaactcatccttcatttcaggatataatgcaaaatatt
gatctggtgatctccttctttagctcaaggttgctgcaagctggagctgagctgtcagtg
gaacgggtcctggaaatcattaagcaaggcgtcgttgcgctgcccaaagacagactgaag
aaatttccagaattgaaattcaaatatgtggaagaggagcagcccgaggagttttttatc
ccctatgtctggtctcttgtctacaactcagcagtcggcctgtactggaatccacaggac
atccagctgttcaccatggattccgactga

DBGET integrated database retrieval system