KEGG   Homo sapiens (human): 54831Help
Entry
54831             CDS       T01001                                 

Gene name
BEST2, VMD2L1
Definition
bestrophin 2
Orthology
K13879  
bestrophin-2
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    54831 (BEST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 509 aa AA seqDB search
MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKR
YFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDR
GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNK
YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVV
TIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGE
DDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSF
QGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRK
NSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEP
FSIVTMPGPRGPAPPWLPSPIGEEEENLA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcacctacacagcccgagtggcgaacgcccgcttcggtggcttctcccagctg
ctgctactgtggcgtgggagcatctacaaactcctgtggcgagagctgctctgcttcctt
gggttctacatggcgctgagtgctgcctaccgctttgtgctgaccgaagggcagaagcgc
tacttcgagaagcttgtgatttattgtgaccagtatgccagcctcatccctgtctccttc
gtgcttggcttttatgtgacgctggtggtgaaccgctggtggagccagtacctatgcatg
ccgctgcccgacgcgctcatgtgcgtggtggcgggcaccgtgcacggacgcgacgaccgc
ggccgcctctaccggcgcacactcatgcgctacgcagggctctcggccgtgctcatcctg
cgctccgtcagcaccgcggtgttcaagcgcttccccaccatagaccacgtggtggaggct
gggtttatgacccgcgaggagcgcaagaagtttgaaaacctgaactcatcctacaacaag
tactgggtgccctgcgtctggttctccaacctggcggcacaggcccgacgcgagggccgc
atccgcgacaacagcgcccttaagctgctgctcgaggagctgaatgtttttcggggcaaa
tgtggaatgctctttcactatgactggattagcgtacccctcgtgtacacgcaggtggtg
accatcgcactgtacagctacttcctggcttgcctcattggtcgccagttcctggacccg
gctcagggttacaaagaccacgacctagacctgtgtgtgcccatcttcaccctcttgcag
ttcttcttctacgccggctggctcaaggtagctgagcagctcatcaaccccttcggagag
gacgatgatgactttgagaccaactttctgatcgatagaaacttccaggtgtccatgctg
gcagtggacgagatgtatgatgacctggctgtgctggagaaggacttgtactgggatgca
gccgaggctcgcgccccatacacagcggctactgtcttccagctgcggcagccttccttc
cagggctccacctttgacatcacgctggccaaagaagacatgcagttccagcggctggac
ggcttggatggaccgatgggagaggcgcccggcgacttcctgcagcgcctcctgccggcg
ggcgcgggcatggtcgcgggaggcccgctgggccggcgcctgtcctttctactccgcaag
aacagctgcgtgtcggaggcgtctactggggccagctgctcatgcgcggttgtccccgaa
ggcgcggccccggagtgcagctgcggggacccgctgctcgaccccggcctgccggagccc
gaggccccgccccctgcgggtcccgaaccgcttaccctcatccctgggcctgtcgagccc
ttcagcatcgtgaccatgcccgggccccggggtccggcgccaccctggctgcccagccct
attggcgaggaggaggagaatctggcctga

DBGET integrated database retrieval system