KEGG   Homo sapiens (human): 54851Help
Entry
54851             CDS       T01001                                 

Gene name
ANKRD49, FGIF, GBIF
Definition
(RefSeq) ankyrin repeat domain 49
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q21
AA seq 239 aa AA seqDB search
MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNE
EWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGH
LDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaaaaggaaatgatgatggaataccagaccaagagaattccttggatttt
tctgaacactttaaccaacttgaattgttggaaacacatggacaccttattcctactggt
actcaaagtctttgggtaggcaattctgatgaagatgaggagcaagatgacaaaaatgaa
gagtggtatcgattgcaagaaaaaaaaatggaaaaagacccaagcagattgcttctttgg
gctgctgaaaaaaatcggcttaccacagtgcggagactcctttctgaaaaggccactcac
gtgaacactagggatgaagatgagtatacccctcttcatcgagcagcctacagtggacac
ttagatattgttcaggagctcattgcacagggggccgatgttcatgcagtgactgtggat
ggctggacgcccctgcacagtgcttgtaagtggaataataccagagtggcttctttctta
ctgcagcatgatgcagatatcaatgcccaaacaaaaggcctcttgacccccttgcatctt
gctgctgggaacagagacagcaaggataccctagaactcctcctgatgaaccgttacgtc
aaaccagggctgaaaaacaacttggaagaaactgcatttgatattgccaggaggacaagt
atctatcactacctctttgaaattgtggaaggctgtacaaattcttcacctcagtcttaa

DBGET integrated database retrieval system