KEGG   Homo sapiens (human): 54876Help
Entry
54876             CDS       T01001                                 

Gene name
DCAF16, C4orf30
Definition
DDB1 and CUL4 associated factor 16
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.31
AA seq 216 aa AA seqDB search
MGPRNPSPDHLSESESEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLL
KYSTTWKPLNPNSWLYHAKLLDPSTPVHILREIGLRLSHCSHCVPKLEPIPEWPPLASCG
VPPFQKPLTSPSRLSRDHATLNGALQFATKQLSRTLSRATPIPEYLKQIPNSCVSGCCCG
WLTKTVKETTRTEPINTTYSYTDFQKAVNKLLTASL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctagaaatccctctcctgaccacttgtcagaatcagaaagtgaggaagaagaa
aatattagttacctaaatgagagttctggggaagagtgggattcctctgaagaagaggac
tctatggtgcccaacttatcgcctcttgagagtcttgcctggcaggttaagtgcctttta
aaatattccacaacttggaaacctttaaatcctaattcctggttgtatcatgctaaactg
ttggatccaagcacaccagtccatatacttcgagagataggtctaagactctcccattgt
tcccattgtgtccccaaactggaaccaattcctgaatggccccctctggcctcttgtgga
gtcccaccttttcaaaagcctcttacaagtcccagccggctctctagagatcatgccact
ctaaatggagcactgcaatttgccaccaaacagctaagccgaacattgagtagagccact
cccatacctgaatacctaaaacagatccctaattcatgtgtttctgggtgttgctgtggc
tggctgactaaaacagttaaggaaacaactcgtactgaacccatcaacactacttattct
tacactgacttccaaaaggcagttaacaaactcctaactgcatcactgtaa

DBGET integrated database retrieval system