KEGG   Homo sapiens (human): 54878Help
Entry
54878             CDS       T01001                                 

Gene name
DPP8, DP8, DPRP-1, DPRP1, MST097, MSTP097, MSTP135, MSTP141
Definition
(RefSeq) dipeptidyl peptidase 8
  KO
K08655  
dipeptidyl-peptidase 8 [EC:3.4.14.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     54878 (DPP8)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   54878 (DPP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22
AA seq 898 aa AA seqDB search
MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQ
LKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPK
TINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLF
QAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISN
IVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGGKILR
ILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVI
DKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVM
ERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLY
KITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYF
EGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLY
KLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGK
KYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEGAFKY
KMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAP
VTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAH
TSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagagatctgagcagatgaaaataaaatcaggaaaatgcaacatggcagcagca
atggaaacagaacagctgggtgttgagatatttgaaactgcggactgtgaggagaatatt
gaatcacaggatcggcctaaattggagcctttttatgttgagcggtattcctggagtcag
cttaaaaagctgcttgccgataccagaaaatatcatggctacatgatggctaaggcacca
catgatttcatgtttgtgaagaggaatgatccagatggacctcattcagacagaatctat
taccttgccatgtctggtgagaacagagaaaatacactgttttattctgaaattcccaaa
actatcaatagagcagcagtcttaatgctctcttggaagcctcttttggatctttttcag
gcaacactggactatggaatgtattctcgagaagaagaactattaagagaaagaaaacgc
attggaacagtcggaattgcttcttacgattatcaccaaggaagtggaacatttctgttt
caagccggtagtggaatttatcacgtaaaagatggagggccacaaggatttacgcaacaa
cctttaaggcccaatctagtggaaactagttgtcccaacatacggatggatccaaaatta
tgccctgctgatccagactggattgcttttatacatagcaacgatatttggatatctaac
atcgtaaccagagaagaaaggagactcacttatgtgcacaatgagctagccaacatggaa
gaagatgccagatcagctggagtcgctacctttgttctccaagaagaatttgatagatat
tctggctattggtggtgtccaaaagctgaaacaactcccagtggtggtaaaattcttaga
attctatatgaagaaaatgatgaatctgaggtggaaattattcatgttacatcccctatg
ttggaaacaaggagggcagattcattccgttatcctaaaacaggtacagcaaatcctaaa
gtcacttttaagatgtcagaaataatgattgatgctgaaggaaggatcatagatgtcata
gataaggaactaattcaaccttttgagattctatttgaaggagttgaatatattgccaga
gctggatggactcctgagggaaaatatgcttggtccatcctactagatcgctcccagact
cgcctacagatagtgttgatctcacctgaattatttatcccagtagaagatgatgttatg
gaaaggcagagactcattgagtcagtgcctgattctgtgacgccactaattatctatgaa
gaaacaacagacatctggataaatatccatgacatctttcatgtttttccccaaagtcac
gaagaggaaattgagtttatttttgcctctgaatgcaaaacaggtttccgtcatttatac
aaaattacatctattttaaaggaaagcaaatataaacgatccagtggtgggctgcctgct
ccaagtgatttcaagtgtcctatcaaagaggagatagcaattaccagtggtgaatgggaa
gttcttggccggcatggatctaatatccaagttgatgaagtcagaaggctggtatatttt
gaaggcaccaaagactcccctttagagcatcacctgtacgtagtcagttacgtaaatcct
ggagaggtgacaaggctgactgaccgtggctactcacattcttgctgcatcagtcagcac
tgtgacttctttataagtaagtatagtaaccagaagaatccacactgtgtgtccctttac
aagctatcaagtcctgaagatgacccaacttgcaaaacaaaggaattttgggccaccatt
ttggattcagcaggtcctcttcctgactatactcctccagaaattttctcttttgaaagt
actactggatttacattgtatgggatgctctacaagcctcatgatctacagcctggaaag
aaatatcctactgtgctgttcatatatggtggtcctcaggtgcagttggtgaataatcgg
tttaaaggagtcaagtatttccgcttgaataccctagcctctctaggttatgtggttgta
gtgatagacaacaggggatcctgtcaccgagggcttaaatttgaaggcgcctttaaatat
aaaatgggtcaaatagaaattgacgatcaggtggaaggactccaatatctagcttctcga
tatgatttcattgacttagatcgtgtgggcatccacggctggtcctatggaggatacctc
tccctgatggcattaatgcagaggtcagatatcttcagggttgctattgctggggcccca
gtcactctgtggatcttctatgatacaggatacacggaacgttatatgggtcaccctgac
cagaatgaacagggctattacttaggatctgtggccatgcaagcagaaaagttcccctct
gaaccaaatcgtttactgctcttacatggtttcctggatgagaatgtccattttgcacat
accagtatattactgagttttttagtgagggctggaaagccatatgatttacagatctat
cctcaggagagacacagcataagagttcctgaatcgggagaacattatgaactgcatctt
ttgcactaccttcaagaaaaccttggatcacgtattgctgctctaaaagtgatataa

DBGET integrated database retrieval system