KEGG   Homo sapiens (human): 54880Help
Entry
54880             CDS       T01001                                 

Gene name
BCOR, ANOP2, MAA2, MCOPS2
Definition
(RefSeq) BCL6 corepressor
Organism
hsa  Homo sapiens (human)
Disease
H01027  
Anophthalmia and microphthalmia (A/M)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.4
AA seq 1755 aa AA seqDB search
MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDAST
AHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNP
EMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLN
INGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTN
GERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVD
SHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKH
YARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGS
EIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQR
SSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQ
PPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPY
PAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDAL
GLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVP
TDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPF
LEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPS
KLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAM
MRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERC
EYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSG
DSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIEL
TGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAK
QQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLT
GEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSP
QETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCA
LHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLAT
YSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANP
PGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSS
VEWLHPSDLASDNYW
NT seq 5268 nt NT seq  +upstreamnt  +downstreamnt
atgctctcagcaacccccctgtatgggaacgttcacagctggatgaacagcgagagggtc
cgcatgtgtggggcgagcgaagacaggaaaatccttgtaaatgatggtgacgcttcaaaa
gccagactggaactgagggaagagaatcccttgaaccacaacgtggtggatgcgagcacg
gcccataggatcgatggcctggcagcactgagcatggaccgcactggcctgatccgggaa
gggctgcgggtcccgggaaacatcgtctattctagcttgtgtggactgggctcagagaaa
ggtcgggaggctgccacaagcactctaggtggccttgggttttcttcggaaagaaatcca
gagatgcagttcaaaccgaatacacccgagacagtggaggcttctgccgtctctggaaaa
cccccaaatggcttcagtgctatatacaaaacaccgcctggaatacaaaaaagtgctgta
gccacagcagaagcgctgggcttggacaggcctgccagcgacaaacagagccctctcaac
atcaatggtgctagttatctgcggctgccctgggtcaatccttacatggagggtgccacg
ccagccatctaccctttcctcgactcgccaaataagtattcactgaacatgtacaaggcc
ttgctacctcagcagtcctacagcttggcccagccgctgtattctccagtctgcaccaat
ggggagcgctttctctacctgccgccacctcactacgtcggtccccacatcccatcgtcc
ttggcatcacccatgaggctctcgacaccttcggcctccccagccatcccgcctctcgtc
cattgcgcagacaaaagcctcccgtggaagatgggcgtcagccctgggaatcctgttgat
tcccacgcctatcctcacatccagaacagtaagcagcccagggttccctctgccaaggcg
gtcaccagtggcctgccgggggacacagctctcctgttgcccccctcgcctcggccgtca
ccccgagtccaccttcccacccagcctgctgcagacacctactcggagttccacaagcac
tatgccaggatctccacctctccttcagttgccctgtcaaagccatacatgacagttagc
agcgagttccccgcggccaggctctccaatggcaagtatcccaaggctccggaagggggc
gaaggtgcccagccagtgcccgggcatgcccggaagacagcggttcaagacagaaaagat
ggcagctcacctcctctgttggagaagcagaccgttaccaaagacgtcacagataagcca
ctagacttgtcttctaaagtggtggatgtagatgcttccaaagctgaccacatgaaaaag
atggctcccacggtcctggttcacagcagggctggaagtggcttagtgctctccggaagt
gagattccgaaagaaacactatctcctccaggaaatggttgtgctatctatagatctgaa
atcatcagcactgctccctcatcctgggtggtgcccgggccaagtcctaacgaagagaac
aatggcaaaagcatgtcgctgaaaaacaaggcattggactgggcgataccacagcagcgg
agttcatcatgcccgcgcatgggcggcaccgatgctgtcatcactaacgtttcagggtca
gtgtcgagtgcaggccgcccagcctccgcatcacccgcccccaatgccaatgcagatggc
accaaaaccagcaggagctctgtagaaaccacaccatccgttattcagcacgtgggccag
cccccggccactcctgccaagcacagtagcagcaccagcagcaagggcgccaaagccagc
aacccagaaccgagtttcaaagcaaacgagaacggccttccaccaagctctatatttctg
tctccaaatgaggcattcaggtccccaccaattccctaccccaggagttacctcccttac
ccagcccctgagggcattgctgtaagtcccctctccttacatggcaaaggacctgtctac
cctcacccagttttgttacccaatggcagtctgtttcctgggcaccttgccccaaagcct
gggctgccctatgggcttcccaccggccgtccagagtttgtgacctaccaagatgccctg
gggttgggcatggtgcatcccatgttgataccacacacgcccatagagattactaaagag
gagaaaccagagaggagatcccggtcccatgagagagcccgttacgaggacccaaccctc
cggaatcggttttccgagattttggaaactagcagcaccaagttacatccagatgtcccc
accgacaagaacctaaagccgaaccccaactggaatcaagggaagactgttgtcaaaagc
gacaagcttgtctacgtagaccttctccgagaagaaccagatgctaaaactgacacaaac
gtgtccaaacccagctttgcagcagagagtgttggccagagcgctgagccccccaagccc
tcagttgagccggccctgcagcagcaccgtgatttcatcgccctgagagaggagttgggg
cgcatcagtgacttccacgaaacttatactttcaaacagccagtcttcaccgtaagcaag
gacagtgttctggcaggtaccaacaaagagaacctagggttgccagtctcgactccattc
ctggagccacctctggggagcgatggccctgctgtaacttttggtaaaacccaagaggat
cccaaaccattttgtgtgggcagtgccccaccaagtgtggatgtgacccccacctatacc
aaagatggagctgatgaggctgaatcaaatgatggcaaagttctgaaaccgaagccatct
aagctggcaaagagaatcgccaactcagcgggttacgtgggtgaccgattcaaatgtgtc
actaccgaactgtatgcagattccagtcagctcagccgggagcaacgggcattgcagatg
gaaggattacaagaggacagtattttatgtctacccgctgcttactgtgagcgtgcaatg
atgcgcttctcagagttggagatgaaagaaagagaaggtggccacccagcaaccaaagac
tccgagatgtgcaaattcagcccagccgactgggaaaggttgaaaggaaatcaggacaaa
aagccaaagtcggtcaccctggaggaggccattgcagaacagaacgaaagtgagagatgc
gagtatagtgttggaaacaagcaccgtgatccctttgaagccccagaggacaaagatctt
cctgtggagaagtactttgtggagaggcagcctgtgagcgagcctcccgcagaccaggtg
gcctcggacatgcctcacagccccaccctccgggtggacaggaaacgcaaagtctcaggt
gacagcagccacactgagaccactgcggaggaggtgccagaggaccctctgctgaaagcc
aaacgccgacgagtctctaaagatgactggcctgagagggaaatgacaaacagttcctct
aaccacttagaagacccacattatagtgagctgaccaacctgaaggtgtgcattgaatta
acagggctccatcctaaaaaacaacgccacttgctgcaccttagagaacgatgggagcag
caggtgtcggcagcagatggcaaacctggccggcaaagcaggaaggaagtgacccaggcc
actcagcctgaggccattcctcaggggactaacatcactgaagagaaacctggcaggaaa
agggcagaggccaaaggcaacagaagctggtcggaagagtctcttaaacccagtgacaat
gaacaaggcttgcctgtgttctccggctctccgcccatgaagagtctttcatccaccagt
gcaggcggcaaaaagcaggctcagccaagctgcgcaccagcctccaggccgcctgccaaa
cagcagaaaattaaagaaaaccagaagacagatgtgctgtgtgcagacgaagaagaggat
tgccaggctgcctccctgctgcagaaatacaccgacaacagcgagaagccatccgggaag
agactgtgcaaaaccaaacacttgatccctcaggagtccaggcggggattgccactgaca
ggggaatactacgtggagaatgccgatggcaaggtgactgtccggagattcagaaagcgg
ccggagcccagttcggactatgatctgtcaccagccaagcaggagccaaagcccttcgac
cgcttgcagcaactgctaccagcctcccagtccacacagctgccatgctcaagttcccct
caggagaccacccagtctcgccctatgccgccggaagcacggagacttattgtcaataag
aacgctggcgagacccttctgcagcgggcagccaggcttggctatgaggaagtggtcctg
tactgcttagagaacaagatttgtgatgtaaatcatcgggacaacgcaggttactgcgcc
ctgcatgaagcttgtgctaggggctggctcaacattgtgcgacacctccttgaatatggc
gctgatgtcaactgtagtgcccaggatggaaccaggcctctgcacgatgctgttgagaac
gatcacttggaaattgtccgactacttctctcttatggtgctgaccccaccttggctacg
tactcaggtagaaccatcatgaaaatgacccacagtgaacttatggaaaagttcttaaca
gattatttaaatgacctccagggtcgcaatgatgatgacgccagtggcacttgggacttc
tatggcagctctgtttgtgaaccagatgatgaaagtggctatgatgttttagccaacccc
ccaggaccagaagaccaggatgatgatgacgatgcctatagcgatgtgtttgaatttgaa
ttttcagagacccccctcttaccgtgttataacatccaagtatctgtggctcaggggcca
cgaaactggctactgctttcggatgtccttaagaaattgaaaatgtcctcccgcatattt
cgctgcaattttccaaacgtggaaattgtcaccattgcagaggcagaattttatcggcag
gtttctgcaagtctcttgttctcttgctccaaagacctggaagccttcaaccctgaaagt
aaggagctgttagatctggtggaattcacgaacgaaattcagactctgctgggctcctct
gtagagtggctccaccccagtgatctggcctcagacaactactggtga

DBGET integrated database retrieval system