KEGG   Homo sapiens (human): 54898Help
Entry
54898             CDS       T01001                                 

Gene name
ELOVL2, SSC2
Definition
(RefSeq) ELOVL fatty acid elongase 2
  KO
K10205  
elongation of very long chain fatty acids protein 2 [EC:2.3.1.199]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    54898 (ELOVL2)
  Lipid metabolism
   00062 Fatty acid elongation
    54898 (ELOVL2)
   01040 Biosynthesis of unsaturated fatty acids
    54898 (ELOVL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     54898 (ELOVL2)
Lipid biosynthesis proteins [BR:hsa01004]
 Elongase
  PUFA
   54898 (ELOVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NXB9(Tbio)
UniProt: 
Position
6p24.2
AA seq 296 aa AA seqDB search
MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRP
ALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYY
FSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIH
ILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSS
YMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaacatctaaaggcctttgatgatgaaatcaatgcttttttggacaatatgtttgga
ccgcgagattctcgagtcagagggtggttcatgttggactcttaccttcctacctttttt
cttactgtcatgtatctgctctcaatatggctgggtaacaagtatatgaagaacagacct
gctctttctctcaggggtatcctcaccttgtataatcttggaatcacacttctctccgcg
tacatgctggcagagctcattctctccacttgggaaggaggctacaacttacagtgtcaa
gatcttaccagcgcaggggaagctgacatccgggtagccaaggtgctttggtggtactat
ttctccaaatcagtagagttcctggacacaattttcttcgttttgcggaaaaaaacgagt
cagattacttttcttcatgtatatcatcatgcttctatgtttaacatctggtggtgtgtc
ttgaactggataccttgtggacaaagtttctttggaccaacactgaacagttttatccac
attcttatgtactcctactatggactttctgtgtttccatctatgcacaagtatctttgg
tggaagaaatatctcacacaggctcagctggtgcagttcgtgctcaccatcacgcacacc
atgagcgccgtcgtgaaaccgtgtggcttccccttcggttgtctcatcttccagtcatct
tatatgctaacgttagtcatcctcttcttaaatttttacgttcagacataccgaaaaaag
ccaatgaagaaagatatgcaagagccacctgcagggaaagaagtgaagaatggtttttcc
aaagcctacttcactgcagcaaatggagtgatgaacaagaaagcacaataa

DBGET integrated database retrieval system