KEGG   Homo sapiens (human): 549Help
Entry
549               CDS       T01001                                 

Gene name
AUH
Definition
(RefSeq) AU RNA binding methylglutaconyl-CoA hydratase
  KO
K05607  
methylglutaconyl-CoA hydratase [EC:4.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Disease
H00754  
3-Methylglutaconic aciduria (MGCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    549 (AUH)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.18  methylglutaconyl-CoA hydratase
     549 (AUH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q13825(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.31
AA seq 339 aa AA seqDB search
MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGG
PAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKS
DKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAID
GLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSA
RVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVD
LVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggtggcggcggcacctggggccttgggatccctgcatgctggcggcgcc
cgcctggtggccgcttgcagtgcgtggctctgcccggggttgaggctgcccggctcgttg
gcaggccggcgagcgggcccggcgatctgggcccagggctgggtacctgcggccgggggt
cccgccccgaaaaggggctacagctctgagatgaagacggaggacgagctgcgggtgcgg
cacctggaggaggagaaccgaggaattgtggtgcttggaataaacagagcttatggcaaa
aattcactcagtaaaaatcttataaaaatgctatcaaaagctgtggatgctttgaaatct
gataagaaagtacggaccataataatcaggagtgaagtcccagggatattctgtgctggt
gctgaccttaaggaaagagccaaaatgagttccagtgaagttggtccttttgtctccaaa
ataagagcagtgattaacgatattgctaatcttccagtaccaacaattgcagcaatagat
ggactcgctttaggtggtggtcttgaactggctttagcctgtgatatacgagtagcagct
tcctctgcaaaaatgggcctggttgaaacaaaattggcgattattcctggtggagggggg
acacagcgattgccacgcgccattggaatgtccctggccaaggagctcatattctctgcg
cgagtcctcgatggcaaagaagccaaagcagtgggcttaatcagccacgttctggaacag
aaccaggagggagacgcggcctacaggaaggccttggacctggcgagagagtttttacct
cagggacctgttgcaatgagagtggcaaaattagcaattaatcaagggatggaggtcgat
ttagtaacagggttagccatagaagaagcttgttatgctcagaccattccaacaaaagac
agacttgaaggtcttcttgcttttaaagagaaaaggccccctcgctataaaggagaataa

DBGET integrated database retrieval system