KEGG   Homo sapiens (human): 54904Help
Entry
54904             CDS       T01001                                 

Gene name
WHSC1L1, NSD3, pp14328
Definition
Wolf-Hirschhorn syndrome candidate 1-like 1 (EC:2.1.1.43)
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2
AA seq 645 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGSADRGVQGSVRFSDSSVSAAIEETVD
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactccgccaacatccgtcaggaggatgcctttgataacaacagtgacatt
gctgaagatggtggccagacaccatatgaagctactttgcagcaaggctttcagtaccca
gctacaacagaagatcttcctccactcacaaatgggtatccatcatcaatcagtgtgtat
gaaactcaaaccaaataccagtcatataatcagtatcctaatgggtcagccaatggcttt
ggtgcagttagaaactttagccccactgactattatcattcagaaattccaaacacaaga
ccacatgaaattctggaaaaaccttcccctccacagccaccacctcctccttcggtacca
caaactgtgattccaaagaagactggctcacctgaaattaaactaaaaataaccaaaact
atccagaatggcagggaattgtttgagtcttccctttgtggagaccttttaaatgaagta
caggcaagtgagcacacgaaatcaaagcatgaaagcagaaaagaaaagaggaaaaaaagc
aacaagcatgactcatcaagatctgaagagcgcaagtcacacaaaatccccaaattagaa
ccagaggaacaaaatagaccaaatgagagggttgacactgtatcagaaaaaccaagggaa
gaaccagtactaaaagaggaagccccagttcagccaatactatcttctgttccaacaacg
gaagtgtccactggtgttaagtttcaggttggcgatcttgtgtggtccaaggtgggaacc
tatccttggtggccttgtatggtttcaagtgatccccagcttgaggttcatactaaaatt
aacacaagaggtgcccgagaatatcatgtccagttttttagcaaccagccagagagggcg
tgggttcatgaaaaacgggtacgagagtataaaggtcataaacagtatgaagaattactg
gctgaggcaaccaaacaagccagcaatcactctgagaaacaaaagattcggaaaccccga
cctcagagagaacgtgctcagtgggatattggcattgcccatgcagagaaagcattgaaa
atgactcgagaagaaagaatagaacagtatacttttatttacattgataaacagcctgaa
gaggctttatcccaagcaaaaaagagtgttgcctccaaaaccgaagttaaaaaaacccga
cgaccaagatctgtgctgaatactcagccagaacagaccaatgcaggggaggtggcctcc
tcactctcaagtactgaaattcggagacatagccagaggcggcacacaagtgcggaagag
gaagagccaccgcctgttaaaatagcctggaaaactgcggcagcaaggaaatccttacca
gcttccattacgatgcacaaagggagcctggatttgcagaagtgtaacatgtctccagtt
gtgaaaattgaacaagtgtttgctcttcagaatgctacaggggatgggaaatttatcgat
caatttgtttattcaacaaagggaattggtaacaaaacagaaataagtgtcagggggcaa
gacaggcttataatttctacaccaaaccagagaaatgaaaagccaacgcagagtgtatca
tctcctgaagcaacatctggttctacaggctcagtagaaaagaagcaacagagaagatca
attagaactcgttctgaatcagagaaatccactgaggttgtgccaaagaagaagatcaaa
aaggagcaggttgaaacagttcctcaggctacagtgaagactggattacagaaagggtcg
gcggaccggggagtgcagggctctgtcagattcagtgacagctccgtctccgcagcgatt
gaggaaactgtggactga

DBGET integrated database retrieval system