KEGG   Homo sapiens (human): 54905Help
Entry
54905             CDS       T01001                                 

Gene name
CYP2W1
Definition
(RefSeq) cytochrome P450 family 2 subfamily W member 1
  KO
K07423  
cytochrome P450 family 2 subfamily W polypeptide 1
Organism
hsa  Homo sapiens (human)
Brite
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   54905 (CYP2W1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8TAV3(Tbio)
UniProt: 
Position
7p22.3
AA seq 490 aa AA seqDB search
MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLSQQDRSLMELS
ERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGA
RWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITF
ALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQLFNVYPWLGALLQLHRPVLRKIEEV
RAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTET
TSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAVLHEVQRFITL
LPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVKR
EAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSPASLDTTPARAFTMRPR
AQALCAVPRP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgctcttgctgttcctgggcctcctggggctctgggggctgctctgcgcc
tgcgcccaagacccctccccagctgcccggtggcccccggggcctcgcccgctgccgctc
gtcgggaacctgcacttgctgcgtctgtcgcaacaggaccggtccctgatggagctctca
gaacgctacgggccggtgttcaccgtgcacctggggcgccagaagacggtggtgctgacg
gggttcgaggcggtcaaagaggcgctggcgggccccgggcaggagctggccgaccggcct
cccatcgccatcttccagctcatccagcgaggtggaggcatcttcttctcatctggggcg
cgctggagggctgcccgccagttcacggtgcgtgccctgcacagcctgggcgtgggccgg
gagccggtggctgacaagattctgcaggagctgaaatgcctctctgggcagctggatggc
tacagaggccggcccttcccgctggccctactgggctgggctccctccaatatcaccttc
gcgctcctcttcggccgccgatttgactaccgggaccccgtgtttgtgtccctgctgggt
ctcatcgatgaggtcatggtcctcttggggtcccctggcctgcagctgttcaacgtctac
ccatggctcggggccctgctccagctgcaccggcccgtcctgcgcaagatcgaggaggtc
cgtgccattctgaggaccctcctggaggcgcggaggccccacgtgtgcccgggggacccc
gtgtgcagctatgtggacgccctgatccagcagggacagggggatgaccccgagggcctg
tttgctgaggccaacgcggtggcctgcaccctggacatggtcatggccgggacggagacg
acctcggccacgctgcagtgggccgcacttctgatgggccggcacccggacgtgcagggc
cgggtgcaggaggagctagaccgcgtgctgggccctgggcggactccccggctggaggac
cagcaggctctgccctacacaagcgccgtgctccacgaggtgcagcggttcatcacgctc
ctgccgcacgtgccccgctgcaccgcggccgacacacagctgggcggcttcctgctcccc
aagggcacgcccgtgattcccctgctgacctcggtgctcctggatgagacacagtggcag
accccaggccagttcaaccccggccatttcctggacgcgaatgggcactttgtgaagcgg
gaggccttcctgcctttctctgcaggccgccgcgtctgtgttggggagcgcctggccagg
accgagctcttcctgctgtttgccggcctcctgcagaggtaccgcctgctgcccccgcct
ggcgtcagtccggcctccctggacaccacgcccgcccgggcttttaccatgaggccgagg
gcccaggccctgtgtgcggtgcccaggccctag

DBGET integrated database retrieval system