KEGG   Homo sapiens (human): 54913Help
Entry
54913             CDS       T01001                                 

Gene name
RPP25
Definition
(RefSeq) ribonuclease P/MRP subunit p25
  KO
K14525  
ribonucleases P/MRP protein subunit RPP25 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    54913 (RPP25)
   03008 Ribosome biogenesis in eukaryotes
    54913 (RPP25)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     54913 (RPP25)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     54913 (RPP25)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    54913 (RPP25)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    54913 (RPP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BUL9(Tdark)
UniProt: 
Position
15q24.2
AA seq 199 aa AA seqDB search
MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQP
ATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPG
EPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGE
GSAKRSQPEPGVADEDQTA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccgtaaggtgcgctccgaagaggcgccagcggggtgcggggccgaggga
ggcggcccgggctccggccccttcgcagacctggcgccgggcgcggtgcacatgcgggtc
aaggaaggcagcaagatccggaacctgatggccttcgccaccgccagcatggcgcagcca
gccacgcgcgccatcgtcttcagcggctgcggccgggccaccaccaaaaccgtcacgtgc
gccgagatcctcaagcgccgcctggcgggcctgcaccaggtcacgcggctgcgctaccgg
agcgtacgcgaggtgtggcagagcctcccgcctgggcccacgcagggtcagacgcctggc
gagccggccgctagtctcagcgtacttaagaacgtgcccggcctcgccatcctactttcc
aaggacgcgctggatccgcgacagcccggctaccagcccccgaatccccatcctggtccc
tcgtccccgccagccgcgccagcgtccaagaggagcctaggggaacccgcagctggagaa
ggctccgcgaagcgatcgcaacccgagccaggggttgcggacgaggatcagacggcctga

DBGET integrated database retrieval system