KEGG   Homo sapiens (human): 54926Help
Entry
54926             CDS       T01001                                 

Gene name
UBE2R2, CDC34B, E2-CDC34B, UBC3B
Definition
ubiquitin-conjugating enzyme E2R 2 (EC:6.3.2.19)
Orthology
K02207  
ubiquitin-conjugating enzyme E2 R [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13.3
AA seq 238 aa AA seqDB search
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcagatgaccagctcgcagaaggccctgatgctcgagctgaaatccctg
caggaggaaccggtggagggcttccggatcaccctggtggacgagtccgacctctacaac
tgggaggtggccatcttcggaccccccaacaccctctacgaaggcggctacttcaaggcg
catattaaatttcctattgactacccctattcaccacctaccttcagattcttgaccaaa
atgtggcaccccaacatttatgagaatggagatgtatgcatttcgattcttcatccgcct
gtagatgacccacagagtggagaactgccttctgaaaggtggaatcctactcagaatgtg
aggactatcctattaagtgtaatctcactgcttaatgagcccaacaccttctccccagcc
aatgtcgatgcttcagttatgttcaggaaatggagagacagtaaaggaaaagacaaagaa
tatgctgaaattattaggaaacaagtttcagccactaaggccgaagcagaaaaggatgga
gtgaaggtccccacaaccctggcggaatactgcatcaaaactaaagtgccttccaatgac
aacagctcagatttgctttacgacgacttgtatgatgacgacattgatgatgaagatgag
gaggaggaagatgccgactgttatgatgatgatgattctgggaatgaggagtcgtga

DBGET integrated database retrieval system