KEGG   Homo sapiens (human): 54926Help
Entry
54926             CDS       T01001                                 

Gene name
UBE2R2, CDC34B, E2-CDC34B, UBC3B
Definition
ubiquitin-conjugating enzyme E2R 2 (EC:6.3.2.19)
Orthology
K02207  
ubiquitin-conjugating enzyme E2 R [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    54926 (UBE2R2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    54926 (UBE2R2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     54926 (UBE2R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13.3
AA seq 238 aa AA seqDB search
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcagatgaccagctcgcagaaggccctgatgctcgagctgaaatccctg
caggaggaaccggtggagggcttccggatcaccctggtggacgagtccgacctctacaac
tgggaggtggccatcttcggaccccccaacaccctctacgaaggcggctacttcaaggcg
catattaaatttcctattgactacccctattcaccacctaccttcagattcttgaccaaa
atgtggcaccccaacatttatgagaatggagatgtatgcatttcgattcttcatccgcct
gtagatgacccacagagtggagaactgccttctgaaaggtggaatcctactcagaatgtg
aggactatcctattaagtgtaatctcactgcttaatgagcccaacaccttctccccagcc
aatgtcgatgcttcagttatgttcaggaaatggagagacagtaaaggaaaagacaaagaa
tatgctgaaattattaggaaacaagtttcagccactaaggccgaagcagaaaaggatgga
gtgaaggtccccacaaccctggcggaatactgcatcaaaactaaagtgccttccaatgac
aacagctcagatttgctttacgacgacttgtatgatgacgacattgatgatgaagatgag
gaggaggaagatgccgactgttatgatgatgatgattctgggaatgaggagtcgtga

DBGET integrated database retrieval system