KEGG   Homo sapiens (human): 5494Help
Entry
5494              CDS       T01001                                 

Gene name
PPM1A, PP2C-ALPHA, PP2CA, PP2Calpha
Definition
protein phosphatase, Mg2+/Mn2+ dependent, 1A (EC:3.1.3.16)
Orthology
K04457  
protein phosphatase 1A [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.1
AA seq 382 aa AA seqDB search
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggagcatttttagacaagccaaagatggaaaagcataatgcccaggggcagggtaat
gggttgcgatatgggctaagcagcatgcaaggctggcgtgttgaaatggaggatgcacat
acggctgtgatcggtttgccaagtggacttgaatcgtggtcattctttgctgtgtatgat
gggcatgctggttctcaggttgccaaatactgctgtgagcatttgttagatcacatcacc
aataaccaggattttaaagggtctgcaggagcaccttctgtggaaaatgtaaagaatgga
atcagaacaggttttctggagattgatgaacacatgagagttatgtcagagaagaaacat
ggtgcagatagaagtgggtcaacagctgtaggtgtcttaatttctccccaacatacttat
ttcattaactgtggagactcaagaggtttactttgtaggaacaggaaagttcatttcttc
acacaagatcacaaaccaagtaatccgctggagaaagaacgaattcagaatgcaggtggc
tctgtaatgattcagcgtgtgaatggctctctggctgtatcgagggcccttggggatttt
gattacaaatgtgtccatggaaaaggtcctactgagcagcttgtctcaccagagcctgaa
gtccatgatattgaaagatctgaagaagatgatcagttcattatccttgcatgtgatggt
atctgggatgttatgggaaatgaagagctctgtgattttgtaagatccagacttgaagtc
actgatgaccttgagaaagtttgcaatgaagtagtcgacacctgtttgtataagggaagt
cgagacaacatgagtgtgattttgatctgttttccaaatgcacccaaagtatcgccagaa
gcagtgaagaaggaggcagagttggacaagtacctggaatgcagagtagaagaaatcata
aagaagcagggggaaggcgtccccgacttagtccatgtgatgcgcacattagcgagtgag
aacatccccagcctcccaccagggggtgaattggcaagcaagaggaatgttattgaagcc
gtttacaatagactgaatccttacaaaaatgacgacactgactctacatcaacagatgat
atgtggtaa

DBGET integrated database retrieval system