KEGG   Homo sapiens (human): 54941Help
Entry
54941             CDS       T01001                                 

Gene name
RNF125, TNORS, TRAC-1, TRAC1
Definition
(RefSeq) ring finger protein 125, E3 ubiquitin protein ligase
  KO
K12170  
E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    54941 (RNF125)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     54941 (RNF125)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    54941 (RNF125)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q12.1
AA seq 232 aa AA seqDB search
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgtgctgagcaccgacagcggcaaatcggcgcccgcctctgccaccgcgcgg
gccctggagcgcaggagggacccggagttgcccgtcacgtccttcgactgcgccgtgtgc
cttgaggtgttacaccagcctgtccggacccgctgtggccacgtattctgccgttcctgt
attgctaccagtctaaagaacaacaagtggacctgtccttattgccgggcatatcttcct
tcagaaggagttccagcaactgatgtagccaaaagaatgaaatcagagtataagaactgc
gctgagtgtgacaccctggtttgcctcagtgaaatgagggcacatattcggacttgtcag
aagtacatagataagtatggaccactacaagaacttgaggagacagcagcaaggtgtgta
tgtcccttttgtcagagggaactgtatgaagacagcttgctggatcattgtattactcat
cacagatcggaacggaggcctgtgttctgtccactttgccgtttaatacccgatgagaat
ccaagcagcttcagtggcagtttaataagacatctgcaagttagtcacactttgttttat
gatgatttcatagattttaatataattgaggaagctcttatccgaagagtcttagaccgg
tcacttcttgaatatgtgaatcactcgaacaccacataa

DBGET integrated database retrieval system