KEGG   Homo sapiens (human): 54941Help
Entry
54941             CDS       T01001                                 

Gene name
RNF125, TRAC-1, TRAC1
Definition
ring finger protein 125, E3 ubiquitin protein ligase
Orthology
K12170  
E3 ubiquitin-protein ligase RNF125 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    54941 (RNF125)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     54941 (RNF125)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q12.1
AA seq 232 aa AA seqDB search
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgtgctgagcaccgacagcggcaaatcggcgcccgcctctgccaccgcgcgg
gccctggagcgcaggagggacccggagttgcccgtcacgtccttcgactgcgccgtgtgc
cttgaggtgttacaccagcctgtccggacccgctgtggccacgtattctgccgttcctgt
attgctaccagtctaaagaacaacaagtggacctgtccttattgccgggcatatcttcct
tcagaaggagttccagcaactgatgtagccaaaagaatgaaatcagagtataagaactgc
gctgagtgtgacaccctggtttgcctcagtgaaatgagggcacatattcggacttgtcag
aagtacatagataagtatggaccactacaagaacttgaggagacagcagcaaggtgtgta
tgtcccttttgtcagagggaactgtatgaagacagcttgctggatcattgtattactcat
cacagatcggaacggaggcctgtgttctgtccactttgccgtttaatacccgatgagaat
ccaagcagcttcagtggcagtttaataagacatctgcaagttagtcacactttgttttat
gatgatttcatagattttaatataattgaggaagctcttatccgaagagtcttagaccgg
tcacttcttgaatatgtgaatcactcgaacaccacataa

DBGET integrated database retrieval system