KEGG   Homo sapiens (human): 54941Help
Entry
54941             CDS       T01001                                 

Gene name
RNF125, TNORS, TRAC-1, TRAC1
Definition
(RefSeq) ring finger protein 125
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Disease
H01806  Tenorio syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    54941 (RNF125)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     54941 (RNF125)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    54941 (RNF125)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-Di19 zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 U-box zf-RING_10 zf-Nse zf-RING_6 Rad50_zn_hook zf-rbx1 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 54941
NCBI-ProteinID: NP_060301
OMIM: 610432
HGNC: 21150
Ensembl: ENSG00000101695
Vega: OTTHUMG00000132266
Pharos: Q96EQ8(Tbio)
UniProt: Q96EQ8
Structure
PDB: 

Jmol
Position
18q12.1
AA seq 232 aa AA seqDB search
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDEN
PSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgtgctgagcaccgacagcggcaaatcggcgcccgcctctgccaccgcgcgg
gccctggagcgcaggagggacccggagttgcccgtcacgtccttcgactgcgccgtgtgc
cttgaggtgttacaccagcctgtccggacccgctgtggccacgtattctgccgttcctgt
attgctaccagtctaaagaacaacaagtggacctgtccttattgccgggcatatcttcct
tcagaaggagttccagcaactgatgtagccaaaagaatgaaatcagagtataagaactgc
gctgagtgtgacaccctggtttgcctcagtgaaatgagggcacatattcggacttgtcag
aagtacatagataagtatggaccactacaagaacttgaggagacagcagcaaggtgtgta
tgtcccttttgtcagagggaactgtatgaagacagcttgctggatcattgtattactcat
cacagatcggaacggaggcctgtgttctgtccactttgccgtttaatacccgatgagaat
ccaagcagcttcagtggcagtttaataagacatctgcaagttagtcacactttgttttat
gatgatttcatagattttaatataattgaggaagctcttatccgaagagtcttagaccgg
tcacttcttgaatatgtgaatcactcgaacaccacataa

DBGET integrated database retrieval system