KEGG   Homo sapiens (human): 54946Help
Entry
54946             CDS       T01001                                 

Gene name
SLC41A3, SLC41A1-L2
Definition
(RefSeq) solute carrier family 41 member 3
  KO
K15122  solute carrier family 41
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC41: MgtE-like magnesium transporter
   54946 (SLC41A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MgtE
Motif
Other DBs
NCBI-GeneID: 54946
NCBI-ProteinID: NP_001008485
OMIM: 610803
HGNC: 31046
Ensembl: ENSG00000114544
Vega: OTTHUMG00000162678
Pharos: Q96GZ6(Tdark)
UniProt: Q96GZ6
Position
3q21.2-q21.3
AA seq 507 aa AA seqDB search
MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRE
TAWSIGLQVTVPFMFAGLGLSWAGMLLDYFQHWPVFVEVKDLLTLVPPLVGLKGNLEMTL
ASRLSTAANTGQIDDPQEQHRVISSNLALIQVQATVVGLLAAVAALLLGVVSREEVDVAK
VELLCASSVLTAFLAAFALGVLMVCIVIGARKLGVNPDNIATPIAASLGDLITLSILALV
SSFFYRHKDSRYLTPLVCLSFAALTPVWVLIAKQSPPIVKILKFGWFPIILAMVISSFGG
LILSKTVSKQQYKGMAIFTPVICGVGGNLVAIQTSRISTYLHMWSAPGVLPLQMKKFWPN
PCSTFCTSEINSMSARVLLLLVVPGHLIFFYIIYLVEGQSVINSQTFVVLYLLAGLIQVT
ILLYLAEVMVRLTWHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQ
PFICTQHLIVSLLSFYFPFCLLAKTSI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggatgggacagagacccggcagcggaggctggacagctgtggcaagccaggggagctg
gggcttcctcaccccctcagcacaggaggactccctgtagcctcagaagatggagctctc
agggcccctgagagccaaagcgtgacccccaagccactggagactgagcctagcagggag
accgcctggtccataggccttcaggtgaccgtgcccttcatgtttgcaggcctgggactg
tcctgggccggcatgcttctggactatttccagcactggcctgtgtttgtggaggtgaaa
gaccttttgacattggtgccgcccctggtgggcctgaaggggaacctggagatgacactg
gcatccagactctccacagctgccaacactggacaaattgatgacccccaggagcagcac
agagtcatcagcagcaacctggccctcatccaggtgcaggccactgtcgtggggctcttg
gctgctgtggctgcgctgctgttgggcgtggtgtctcgagaggaagtggatgtcgccaag
gtggagttgctgtgtgccagcagtgtcctcactgccttccttgcagcctttgccctgggg
gtgctgatggtctgtatagtgattggtgctcgaaagctcggggtcaacccagacaacatt
gccacgcccattgcagccagcctgggagacctcatcacactgtccattctggctttggtt
agcagcttcttctacagacacaaagatagtcggtatctgacgccgctggtctgcctcagc
tttgcggctctgaccccagtgtgggtcctcattgccaagcagagcccacccatcgtgaag
atcctgaagtttggctggttcccaatcatcctggccatggtcatcagcagtttcggagga
ctcatcttgagcaaaaccgtttctaaacagcagtacaaaggcatggcgatatttaccccc
gtcatatgtggtgttggtggcaatctggtggccattcagaccagccgaatctcaacctac
ctgcacatgtggagtgcacctggcgtcctgcccctccagatgaagaaattctggcccaac
ccgtgttctactttctgcacgtcagaaatcaattccatgtcagctcgagtcctgctcttg
ctggtggtcccaggccatctgattttcttctacatcatctacctggtggagggtcagtca
gtcataaacagccagacctttgtggtgctctacctgctggcaggcctgatccaggtgaca
atcctgctgtacctcgcagaagtgatggttcggctgacttggcaccaggccctggatcct
gacaaccactgcatcccctaccttacagggctgggggacctgctcggttcaagctccgtg
ggccacactgctgctgtgccaagaaggtgtacagcctccccaggatggggcctcatacaa
cccttcatctgcactcaacatttaatcgtgtccttgctgtctttttattttcctttttgt
ttgttagcaaaaacctctatttag

DBGET integrated database retrieval system