KEGG   Homo sapiens (human): 54949Help
Entry
54949             CDS       T01001                                 

Gene name
SDHAF2, C11orf79, PGL2, SDH5
Definition
(RefSeq) succinate dehydrogenase complex assembly factor 2
  KO
K18168  succinate dehydrogenase assembly factor 2
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-II assembly factors
    54949 (SDHAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sdh5 Peroxidase_2 TFIIE_alpha DUF1689 Reovirus_cap
Motif
Other DBs
NCBI-GeneID: 54949
NCBI-ProteinID: NP_060311
OMIM: 613019
HGNC: 26034
Ensembl: ENSG00000167985
Vega: OTTHUMG00000168279
Pharos: Q9NX18(Tbio)
UniProt: Q9NX18
Position
11q12.2
AA seq 166 aa AA seqDB search
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtctacagtgttctcgacttcgtcgctgatgcttgctctgtcaaggcacagc
ctattgtctcctttgctcagtgtgacatcattcagacgcttctacagaggtgacagccca
acagattcccaaaaggacatgattgaaatccctttgcctccatggcaggagagaactgat
gaatccatagaaaccaaaagagcccgcctgctctatgagagcagaaagaggggaatgttg
gaaaactgcattcttcttagtctttttgctaaagaacatctgcagcacatgacagaaaag
cagctgaacctctatgaccgcctgattaacgagcctagtaatgactgggatatttactac
tgggccacagaagctaaaccagccccagaaatatttgaaaatgaagtcatggccctgctg
agagactttgctaaaaacaaaaacaaagagcagagactgcgtgccccagatcttgagtac
ctctttgaaaagccacgttga

DBGET integrated database retrieval system