KEGG   Homo sapiens (human): 54949Help
Entry
54949             CDS       T01001                                 

Gene name
SDHAF2, C11orf79, PGL2, SDH5
Definition
succinate dehydrogenase complex assembly factor 2
Orthology
K18168  
succinate dehydrogenase assembly factor 2
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-II assembly factors
    54949 (SDHAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q12.2
AA seq 166 aa AA seqDB search
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtctacagtgttctcgacttcgtcgctgatgcttgctctgtcaaggcacagc
ctattgtctcctttgctcagtgtgacatcattcagacgcttctacagaggtgacagccca
acagattcccaaaaggacatgattgaaatccctttgcctccatggcaggagagaactgat
gaatccatagaaaccaaaagagcccgcctgctctatgagagcagaaagaggggaatgttg
gaaaactgcattcttcttagtctttttgctaaagaacatctgcagcacatgacagaaaag
cagctgaacctctatgaccgcctgattaacgagcctagtaatgactgggatatttactac
tgggccacagaagctaaaccagccccagaaatatttgaaaatgaagtcatggccctgctg
agagactttgctaaaaacaaaaacaaagagcagagactgcgtgccccagatcttgagtac
ctctttgaaaagccacgttga

DBGET integrated database retrieval system