KEGG   Homo sapiens (human): 5495Help
Entry
5495              CDS       T01001                                 

Gene name
PPM1B, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
Definition
protein phosphatase, Mg2+/Mn2+ dependent, 1B (EC:3.1.3.16)
Orthology
K04461  
protein phosphatase 1B [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5495 (PPM1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5495 (PPM1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21
AA seq 327 aa AA seqDB search
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAVKKDSELDKHLESRVEGKTNAF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatttttggataaacccaaaactgaaaaacataatgctcatggtgctgggaat
ggtttacgttatggcctgagcagcatgcaaggatggagagtggaaatggaagatgcacac
acagctgttgtaggtattcctcacggcttggaagactggtcattttttgcagtttatgat
ggtcatgctggatcccgagtggcaaattactgctcaacacatttattagaacacatcact
actaacgaagactttagggcagctggaaaatcaggatctgctcttgagctttcagtggaa
aatgttaagaatggtatcagaactggatttttgaaaattgatgaatacatgcgtaacttt
tcagacctcagaaacgggatggacaggagtggttcaactgcagtgggagttatgatttca
cctaagcatatctactttatcaactgtggtgattcacgtgctgttctgtataggaatgga
caagtctgcttttctacccaggatcacaaaccttgcaatccaagggaaaaggagcgaatc
caaaatgcaggaggcagcgtgatgatacaacgtgttaatggttcattagcagtatctcgt
gctctgggggactatgattacaagtgtgttgatggcaagggcccaacagaacaacttgtt
tctccagagcctgaggtttatgaaattttaagagcagaagaggatgaatttatcatcttg
gcttgtgatgggatctgggatgttatgagtaatgaggagctctgtgaatatgttaaatct
aggcttgaggtatctgatgacctggaaaatgtgtgcaattgggtagtggacacttgttta
cacaagggaagtcgagataacatgagtattgtactagtttgcttttcaaatgctcccaag
gtctcagatgaagcggtgaaaaaagattcagagttggataagcacttggaatcacgggtt
gaaggtaagacaaatgctttttaa

DBGET integrated database retrieval system