KEGG   Homo sapiens (human): 5496Help
Entry
5496              CDS       T01001                                 

Gene name
PPM1G, PP2CG, PP2CGAMMA, PPP2CG
Definition
protein phosphatase, Mg2+/Mn2+ dependent, 1G (EC:3.1.3.16)
Orthology
K17499  
protein phosphatase 1G [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5496 (PPM1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 546 aa AA seqDB search
MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYD
GHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGR
PTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEE
PGSQGLNGEAGPEDSTRETPSQENGPTAKAYTGFSSNSERGTEAGQVGEPGIPTGEAGPS
CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEE
AEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKAL
DMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA
LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELL
DQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKK
KKAKRD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctacctctcccagcccaacacggtgaagtgctccggggacggggtcggcgcc
ccgcgcctgccgctgccctacggcttctccgccatgcaaggctggcgcgtctccatggag
gatgctcacaactgtattcctgagctggacagtgagacagccatgttttctgtctacgat
ggacatggaggggaggaagttgccttgtactgtgccaaatatcttcctgatatcatcaaa
gatcagaaggcctacaaggaaggcaagctacagaaggctttagaagatgccttcttggct
attgacgccaaattgaccactgaagaagtcattaaagagctggcacagattgcagggcga
cccactgaggatgaagatgaaaaagaaaaagtagctgatgaagatgatgtggacaatgag
gaggctgcactgctgcatgaagaggctaccatgactattgaagagctgctgacacgctac
gggcagaactgtcacaagggccctccccacagcaaatctggaggtgggacaggcgaggaa
ccagggtcccagggcctcaatggggaggcaggacctgaggactcaactagggaaactcct
tcacaagaaaatggccccacagccaaggcctacacaggcttttcctccaactcggaacgt
gggactgaggcaggccaagttggtgagcctggcattcccactggtgaggctgggccttcc
tgctcttcagcctctgacaagctgcctcgagttgctaagtccaagttctttgaggacagt
gaggatgagtcagatgaggcggaggaagaagaggaagacagtgaggaatgcagcgaggaa
gaggatggctacagcagtgaggaggcagagaatgaggaagatgaggatgacaccgaggag
gctgaagaggacgatgaagaagaagaagaagagatgatggtgccagggatggaaggcaaa
gaggagcctggctctgacagtggtacaacagcggtggtggccctgatacgagggaagcag
ttgattgtagccaacgcaggagactctcgctgtgtggtatctgaggctggcaaagcttta
gacatgtcctatgatcacaaaccagaggatgaagtagaactagcacgcatcaagaatgct
ggtggcaaggtcaccatggatgggcgagtcaacgggggcctcaacctctccagagccatt
ggggaccacttctataagagaaacaagaacctgccacctgaggaacagatgatttcagcc
cttcctgacatcaaggtgctgactctcactgacgaccatgaattcatggtcattgcctgt
gatggcatctggaatgtgatgagcagccaggaagttgtagatttcattcaatcaaagatc
agccagcgtgatgaaaatggggagcttcggttattgtcatccattgtggaagagctgctg
gatcagtgcctggcaccagacacttctggggatggtacagggtgtgacaacatgacctgc
atcatcatttgcttcaagccccgaaacacagcagagctccagccagagagtggcaagcga
aaactagaggaggtgctctctactgagggggctgaagaaaatggcaacagcgacaagaag
aagaaggccaagcgagactag

DBGET integrated database retrieval system