KEGG   Homo sapiens (human): 54961Help
Entry
54961             CDS       T01001                                 

Gene name
SSH3, SSH3L
Definition
slingshot protein phosphatase 3 (EC:3.1.3.16 3.1.3.48)
Orthology
K05766  
protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.2
AA seq 659 aa AA seqDB search
MALVTVSRSPPGSGASTPVGPWDQAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAP
RPPRLRYLLVVSTREGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGG
FSVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQ
SCLNEWTAMADLESLRPPSAEPGGSSEQEQMEQAIRAELWKVLDVSDLESVTSKEIRQAL
ELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILN
MAREIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRS
AATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKV
GGVSPEEHPAPEVSTPFPPLPPEPEGGGEEKVVGMEESQAAPKEEPGPRPRINLRGVMRS
ISLLEPSLELESTSETSDMPEVFSSHESSHEEPLQPFPQLARTKGGQQVDRGPQPALKSR
QSVVTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQASVHDSGEEGEA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtcacagtgagccgttcgcccccgggcagcggcgcctccacgcccgtgggg
ccctgggaccaggcggtccagcgaaggagtcgactccagcgaaggcagagctttgcggtg
ctccgtggggctgtcctgggactgcaggatggaggggacaatgatgatgcagcagaggcc
agttctgagccaacagagaaggccccgagtgaggaggagctccacggggaccagacagac
ttcgggcaaggatcccagagtccccagaagcaggaggagcagaggcagcacctgcacctc
atggtacagctgctgaggccgcaggatgacatccgcctggcagcccagctggaggcaccc
cggcctccccggctccgctacctgctggtagtttctacacgagaaggagaaggtctgagc
caggatgagacggtcctcctgggcgtggatttccctgacagcagctcccccagctgcacc
ctgggcctggtcttgcccctctggagtgacacccaggtgtacttagatggagacgggggc
ttcagcgtgacgtctggtgggcaaagccggatcttcaagcccatctccatccagaccatg
tgggccacactccaggtattgcaccaagcatgtgaggcagctctaggcagcggccttgta
ccgggtggcagtgccctcacctgggccagccactaccaggagagactgaactccgaacag
agctgcctcaatgagtggacggctatggccgacctggagtctctgcggcctcccagcgcc
gagcctggcgggtcctcagaacaggagcagatggagcaggcgatccgtgctgagctgtgg
aaagtgttggatgtcagtgacctggagagtgtcacttccaaagagatccgccaggctctg
gagctgcgcctggggctccccctccagcagtaccgtgacttcatcgacaaccagatgctg
ctgctggtggcacagcgggaccgagcctcccgcatcttcccccacctctacctgggctca
gagtggaacgcagcaaacctggaggagctgcagaggaacagggtcacccacatcttgaac
atggcccgggagattgacaacttctaccctgagcgcttcacctaccacaatgtgcgcctc
tgggatgaggagtcggcccagctgctgccgcactggaaggagacgcaccgcttcattgag
gctgcaagagcacagggcacccacgtgctggtccactgcaagatgggcgtcagccgctca
gcggccacagtgctggcctatgccatgaagcagtacgaatgcagcctggagcaggccctg
cgccacgtgcaggagctccggcccatcgcccgccccaaccctggcttcctgcgccagctg
cagatctaccagggcatcctgacggccagccgccagagccatgtctgggagcagaaagtg
ggtggggtctccccagaggagcacccagcccctgaagtctctacaccattcccacctctt
ccgccagaacctgagggtggtggggaggagaaggttgtaggcatggaagagagccaggca
gccccgaaagaagagcctgggccacggccacgtataaacctccgaggggtcatgaggtcc
atcagtcttctggagccctccttggagctggagagcacctcagagaccagtgacatgcca
gaggtcttctcttcccacgagtcttcacatgaagagcctctgcagcccttcccacagctt
gcaaggaccaagggaggccagcaggtggacagggggcctcagcctgccctgaagtcccgc
cagtcagtggttaccctccagggcagtgccgtggtggccaaccggacccaggccttccag
gagcaggagcaggggcaggggcaggggcagggagagccctgcatttcctctacgcccagg
ttccggaaggtggtgagacaggccagcgtgcatgacagtggagaggagggcgaggcctga

DBGET integrated database retrieval system