KEGG   Homo sapiens (human): 54978Help
Entry
54978             CDS       T01001                                 

Gene name
SLC35F6, ANT2BP, C2orf18, TANGO9
Definition
(RefSeq) solute carrier family 35 member F6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 371 aa AA seqDB search
MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSFQHPFLQAVGMFLGEFS
CLAAFYLLRCRAAGQSDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQML
RGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGD
LLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSG
NPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRT
VVIWALSLALGWEAFHALQILGFLILLIGTALYNGLHRPLLGRLSRGRPLAEESEQERLL
GGTRTPINDAS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaccaagtaccagctgttcctggccgggctcatgcttgttaccggctccatc
aacacgctctcggcaaaatgggcggacaatttcatggccgagggctgtggagggagcaag
gagcacagcttccagcatcccttcctccaggcagtgggcatgttcctgggagaattctcc
tgcctggctgccttctacctcctccgatgcagagctgcagggcaatcagactccagcgta
gacccccagcagcccttcaaccctcttcttttcctgcccccagcgctctgtgacatgaca
gggaccagcctcatgtatgtggctctgaacatgaccagtgcctccagcttccagatgctg
cggggtgcagtgatcatattcactggcctgttctcggtggccttcctgggccggaggctg
gtgctgagccagtggctgggcatcctagccaccatcgcggggctggtggtcgtgggcctg
gctgacctcctgagcaagcacgacagtcagcacaagctcagcgaagtgatcacaggggac
ctgttgatcatcatggcccagatcatcgttgccatccagatggtgctagaggagaagttc
gtctacaaacacaatgtgcacccactgcgggcagttggcactgagggcctctttggcttt
gtgatcctctccctgctgctggtgcccatgtactacatccccgccggctccttcagcgga
aaccctcgtgggacactggaggatgcattggacgccttctgccaggtgggccagcagccg
ctcattgccgtggcactgctgggcaacatcagcagcattgccttcttcaacttcgcaggc
atcagcgtcaccaaggaactgagcgccaccacccgcatggtgttggacagcttgcgcacc
gttgtcatctgggcactgagcctggcactgggctgggaggccttccatgcactgcagatc
cttggcttcctcatactccttataggcactgccctctacaatgggctacaccgtccgctg
ctgggccgcctgtccaggggccggcccctggcagaggagagcgagcaggagagactgctg
ggtggcacccgcactcccatcaatgatgccagctga

DBGET integrated database retrieval system