KEGG   Homo sapiens (human): 5498Help
Entry
5498              CDS       T01001                                 

Gene name
PPOX, PPO, V290M, VP
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Disease
H00202  
Hepatic porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    5498 (PPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     5498 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgcccccctaaggtggtcctagtggagagcagtgagcgtctggga
ggctggattcgctccgttcgaggccctaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccggaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctacccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccaagccccggggcaaa
gagcctgatgagactgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccatcgttccatattactgggc
ctgctgctgggggcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgttgcctcaggccctt
gaaacccacctgactagtaggggggtcagtgttctcagaggccagccggtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgctcagtgagctgctccctgctgaggctgcc
cctctggctcgtgccctgagtgccatcactgcagtgtctgtagctgtggtgaatctgcag
taccaaggagcccatctgcctgtccagggatttggacatttggtgccatcttcagaagat
ccaggagtcctgggaatcgtgtatgactcagttgctttccctgagcaggacgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggctagt
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgctacacaa
ttaggactgaaggagatgccgagccactgcttggtccatctacacaagaactgcattccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctgactgctcac
aggttgcccctgactctggctggagcctcctatgagggagttgctgttaatgactgtata
gagagtgggcgccaggcagcagtcagtgtcctgggcacagaacctaacagctga

DBGET integrated database retrieval system