KEGG   Homo sapiens (human): 54988Help
Entry
54988             CDS       T01001                                 

Gene name
ACSM5
Definition
acyl-CoA synthetase medium-chain family member 5 (EC:6.2.1.2)
Orthology
K01896  
medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.3
AA seq 579 aa AA seqDB search
MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVL
DVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMML
VLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAIS
AECPSLQTKLLVSDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMV
EHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHELPRV
DAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEALNPDVREKWKH
QTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSY
RIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHV
KRVTAPYKYPRKVAFVSELPKTVSGKIQRSKLRSQEWGK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagaccatggctgagacacctagtcctccaggcactgaggaactccagggcattctgt
gggtctcatgggaagccagcacctctacctgttcctcagaagatcgtggccacctgggaa
gccatcagcctgggaaggcagctggtgcctgagtacttcaacttcgcccatgatgtgctg
gatgtgtggagtcggctggaagaggctggacaccgccccccaaatcctgccttctggtgg
gtcaatggcacaggagcagagatcaagtggagctttgaggagctggggaagcagtccagg
aaggcagccaatgtgctggggggtgcatgcggcctgcagcctggggacagaatgatgctg
gtactcccacggctcccggagtggtggctggtcagtgtggcttgcatgcggacagggact
gtgatgattccgggtgtgactcagctgacagagaaggacctcaagtaccggctgcaggcg
tccagggccaagtccattatcaccagtgactccctagctccaagggtggatgccatcagt
gccgaatgcccctccctccagaccaagctgctggtgtcagacagcagtcggccaggctgg
ttgaacttcagggaactcctccgggaggcttctacagagcacaactgcatgaggacaaag
agtcgagacccgctggccatctactttaccagcggaaccaccggggcccccaagatggtc
gagcactcccagagcagctacggactgggttttgtggccagcggaagacggtgggtggcc
ttgaccgaatctgacatcttctggaacacgactgacactggctgggtgaaggcagcctgg
actctcttctctgcctggcctaatggatcttgcatttttgtgcatgagctgccccgagtt
gatgccaaagttatcctgaatactctctccaaattcccgataaccaccctctgctgtgtc
ccaaccatctttcggctgcttgtgcaggaggatctgaccaggtaccagtttcagagcctg
aggcactgtctgaccggaggagaggccctcaaccctgacgtgagggagaagtggaaacac
cagactggtgtggagctgtacgaaggctatggccagtctgaaacggttgtcatctgtgcc
aatccaaaaggcatgaaaatcaagtctggatccatggggaaggcgtccccaccctacgat
gtgcagattgtggatgatgagggcaacgtcctgcctcctggagaagaggggaatgttgcc
gtccgtatcagacccactcggcccttctgtttcttcaattgctatttggacaatcctgag
aagacagctgcatcagaacaaggggacttttacatcacaggggaccgagctcgcatggac
aaggatggctacttttggttcatgggaagaaacgacgatgtgatcaattcttcaagctac
cggatcgggcctgttgaagtggaaagtgccctggcagagcatcctgctgtcctggagtcg
gctgtggtcagcagcccagaccccatcaggggagaggtggtaaaggcatttatagtcctt
actccagcctactcctctcatgacccagaggcactaacgcgggaactccaggagcatgtg
aaaagggtgactgctccatacaaataccccaggaaggtggcctttgtttcagaactgcca
aagacggtttctggaaagatccaaaggagtaaattgcgaagtcaggagtgggggaaatga

DBGET integrated database retrieval system