KEGG   Homo sapiens (human): 54995Help
Entry
54995             CDS       T01001                                 

Gene name
OXSM, FASN2D, KASI, KS
Definition
3-oxoacyl-ACP synthase, mitochondrial (EC:2.3.1.41)
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    54995 (OXSM)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    54995 (OXSM)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    54995 (OXSM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     54995 (OXSM)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   54995 (OXSM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.2
AA seq 376 aa AA seqDB search
MSNCLQNFLKITSTRLLCSRLCQQLRSKRKFFGTVPISRLHRRVVITGIGLVTPLGVGTH
LVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTI
MAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFV
PKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDAGHITAPDPEGEG
ALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKGAT
GHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTN
SFGFGGTNATLCIAGL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaactgcctgcaaaatttcctgaaaattacaagcactcgtcttctatgttcaaga
ttatgccaacagttaagaagtaaaaggaagtttttcggaactgtgccaatatccagattg
cataggcgagttgtcattacaggcattggcttagtgactcctcttggtgttggaactcac
ctggtttgggatcgtcttatcggaggagagagtggaattgtttcactggttggtgaagag
tataagagtatcccttgcagtgttgctgcttatgtgccaagaggtagtgatgaaggtcag
ttcaatgaacaaaactttgtgtccaaatcagatatcaagtccatgtcttctcccaccatc
atggccattggggctgcagaattagccatgaaggattctggctggcatcctcagtcagaa
gctgatcaagtggctactggtgttgcaattggcatgggaatgattcctcttgaagttgtt
tctgaaactgctttgaattttcagacaaaaggttacaataaagttagcccattttttgtc
cctaagattctggtcaatatggcagcaggccaggtcagcattcgatataaactcaagggc
ccaaatcatgcagtatccacagcctgtaccacaggagctcatgctgtgggagactcattt
agatttatagcccatggtgatgctggtcacataactgcccctgatcctgaaggagaaggt
gccttaaggtgtatggctgctgctttaaaagatgcaggtgtgcagcctgaggagatatcc
tatatcaatgcacatgctacttccacaccattgggagatgctgctgaaaacaaagctatc
aaacatctcttcaaagaccatgcatatgcccttgcagtttcctcaactaagggagcaaca
ggacatctgctgggagctgcaggggcagtcgaggcagcttttaccacattagcttgttat
tatcaaaaactaccacctactttaaacctggattgttcggaaccagaatttgatctcaac
tatgttccactaaaggcacaggaatggaaaactgagaaaagatttattggcctcaccaat
tcctttggttttggtggtactaatgcaacactttgtattgctggactgtag

DBGET integrated database retrieval system