KEGG   Homo sapiens (human): 55023Help
Entry
55023             CDS       T01001                                 

Gene name
PHIP, BRWD2, DCAF14, WDR11, ndrp
Definition
(RefSeq) pleckstrin homology domain interacting protein
  KO
K11797  
PH-interacting protein
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     55023 (PHIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WWQ0(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6q14.1
AA seq 1821 aa AA seqDB search
MSCERKGLSELRSELYFLIARFLEDGPCQQAAQVLIREVAEKELLPRRTDWTGKEHPRTY
QNLVKYYRHLAPDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNKSCKHVVW
KGSALAALHCGRPPESPVNYGSPPSIADTLFSRKLNGKYRLERLVPTAVYQHMKMHKRIL
GHLSSVYCVTFDRTGRRIFTGSDDCLVKIWATDDGRLLATLRGHAAEISDMAVNYENTMI
AAGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQFSPLCSGSKRYLSSTGADGTICFWLW
DAGTLKINPRPAKFTERPRPGVQMICSSFSAGGMFLATGSTDHIIRVYFFGSGQPEKISE
LEFHTDKVDSIQFSNTSNRFVSGSRDGTARIWQFKRREWKSILLDMATRPAGQNLQGIED
KITKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPR
VLFSAGHDGNVIVWDLARGVKIRSYFNMIEGQGHGAVFDCKCSPDGQHFACTDSHGHLLI
FGFGSSSKYDKIADQMFFHSDYRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPS
RYQRLVPGRENCREEQLIPQMGVTSSGLNQVLSQQANQEISPLDSMIQRLQQEQDLRRSG
EAVISNTSRLSRGSISSTSEVHSPPNVGLRRSGQIEGVRQMHSNAPRSEIATERDLVAWS
RRVVVPELSAGVASRQEEWRTAKGEEEIKTYRSEEKRKHLTVPKENKIPTVSKNHAHEHF
LDLGESKKQQTNQHNYRTRSALEETPRPSEEIENGSSSSDEGEVVAVSGGTSEEEERAWH
SDGSSSDYSSDYSDWTADAGINLQPPKKVPKNKTKKAESSSDEEEESEKQKQKQIKKEKK
KVNEEKDGPISPKKKKPKERKQKRLAVGELTENGLTLEEWLPSTWITDTIPRRCPFVPQM
GDEVYYFRQGHEAYVEMARKNKIYSINPKKQPWHKMELREQELMKIVGIKYEVGLPTLCC
LKLAFLDPDTGKLTGGSFTMKYHDMPDVIDFLVLRQQFDDAKYRRWNIGDRFRSVIDDAW
WFGTIESQEPLQLEYPDSLFQCYNVCWDNGDTEKMSPWDMELIPNNAVFPEELGTSVPLT
DGECRSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVV
AYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFI
KDQTCYNIIPLYNSMKKKVLSDSEDEEKDADVPGTSTRKRKDHQPRRRLRNRAQSYDIQA
WKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPME
LCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKR
RKKRNRSSSVSSSAASSPERKKRILKPQLKSESSTSAFSTPTRSIPPRHNAAQINGKTES
SSVVRTRSNRVVVDPVVTEQPSTSSAAKTFITKANASAIPGKTILENSVKHSKALNTLSS
PGQSSFSHGTRNNSAKENMEKEKPVKRKMKSSVLPKASTLSKSSAVIEQGDCKNNALVPG
TIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVH
PIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLRR
SNRKKIDDPIDEEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFG
TSSRGRVRKLTEKAKANLIGW
NT seq 5466 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtgagaggaaaggcctctcggagctgcgatcggagctctacttcctcatcgcc
cggttcctggaagatggaccctgtcagcaggcggctcaggtgctgatccgcgaggtggcc
gagaaggagctgctgccccggcgcaccgactggaccgggaaggagcatcccaggacctac
cagaatctggtgaagtattacagacacttagcacctgatcacttgctgcaaatatgtcat
cgactaggacctcttcttgaacaagaaattcctcaaagtgttcctggagtacaaacttta
ttaggagctggaagacagtctttactacgcacaaataaaagctgcaagcatgttgtgtgg
aaaggatctgctctggctgcgttgcactgtggaagaccacctgagtcaccagttaactat
ggtagcccacccagcattgcggatactctgttttcaaggaagctgaatgggaaatacaga
cttgagcgacttgttccaactgcagtgtatcagcacatgaaaatgcataaacgaattctt
ggacacttgtcatctgtgtactgtgtaacttttgatcgaactggcagacggatatttact
ggttctgatgactgtcttgtgaaaatatgggcaacagatgatgggaggttgttagctacc
ttaagaggacatgctgctgaaatatcagacatggctgtaaactatgagaataccatgata
gcagctggaagttgtgataaaatgatccgagtctggtgtcttcgaacctgtgcacctttg
gctgttcttcagggccatagtgcatctattacatcactacagttctcaccattgtgcagt
ggctcaaagagatatctatcttctactggggcagatggcactatttgtttttggctctgg
gatgctggaacccttaaaataaacccaagacctgcaaaatttacagagcgccctcggcct
ggagttcaaatgatctgttcttcttttagtgctggtggaatgtttctggcgacgggaagc
acagatcatattattcgggtttatttttttggatcaggtcagccagagaaaatatcagaa
ttggagtttcatactgacaaagttgacagtatccagttttccaacactagtaacaggttt
gtaagtggcagtcgtgatgggacagcacgtatttggcaatttaaacgaagagagtggaag
agcattttgttggatatggctactcgtccagcaggccaaaaccttcaaggaatagaagat
aaaatcacaaaaatgaaggttactatggtagcttgggatcgacatgacaatacagttata
actgcagttaataacatgactctgaaagtttggaattcttacactggtcaactaattcat
gtcctgatgggtcatgaagatgaggtatttgttcttgaaccacacccgttcgatcctaga
gttctcttttctgctggtcatgatggaaacgtgatagtgtgggatctggcaagaggagtc
aaaatacgatcttatttcaatatgattgaaggccaaggacatggcgcagtatttgactgc
aaatgctctcctgatggtcagcattttgcatgcacagactctcatggacatcttttaatt
tttggctttgggtccagtagcaaatatgacaagatagcagatcagatgttctttcatagt
gattatcggccacttattcgtgatgccaacaattttgtattagatgaacagactcagcaa
gcacctcatcttatgcctcccccttttttggttgatgttgatggtaaccctcatccatca
agatatcaaagattagttcctggccgtgaaaattgcagggaggagcaactcatccctcag
atgggagtaacttcctcaggactgaatcaagttttaagtcagcaagcaaaccaggagatc
agcccactggacagcatgattcaaagactacaacaggagcaagacctgagacgttctggt
gaagcagttatcagtaataccagccgtttaagtagaggctccataagttctacctcagag
gttcattcaccaccaaacgtaggactaagacgtagtggacaaattgaaggtgtacggcaa
atgcacagcaacgcaccaagaagtgaaatagccacagagcgggatctggtagcttggagt
cgaagggtggtagtacccgagctatcagctggtgtagccagtaggcaagaagaatggaga
actgcaaagggagaagaagaaataaagacttacaggtcagaagagaaaagaaaacactta
actgttccaaaagagaataaaatacccactgtctcaaagaatcatgctcatgagcatttc
ctggatcttggagaatccaaaaagcaacagacaaatcaacacaattatcgtacaagatct
gcattggaagagactcctagaccctcagaagagatagaaaatggcagtagttcttcagat
gaaggcgaagtagttgctgtcagtggtggaacatccgaagaagaagagagagcatggcac
agtgatggcagttctagtgactactccagtgattactctgactggacagcagatgcagga
attaatctgcagccaccaaagaaagttcctaagaataaaaccaagaaagcagaaagcagt
tcagatgaagaagaagaatctgaaaaacagaagcaaaaacagattaaaaaggaaaagaaa
aaagtaaatgaagaaaaagatggaccaatatcaccaaagaaaaagaagcccaaagaaaga
aaacaaaagagattggctgtgggagaactaactgaaaatggtttgacattagaagaatgg
ttgccatcaacatggattacagataccattccccgaagatgtccatttgtgccacagatg
ggtgatgaggtttattatttccgacaaggacatgaagcctatgtcgaaatggcccggaaa
aataaaatatatagtatcaatcccaaaaaacaaccatggcataaaatggagctacgggaa
caagaacttatgaaaatagttggcataaagtatgaagtgggattacctaccctttgctgc
cttaaacttgcttttctagatcctgatactggtaaactgactggcggatcatttaccatg
aaataccatgatatgcctgacgttatagatttcctagtcttgagacaacaatttgatgat
gcaaaatacaggcgatggaatataggtgaccgcttcaggtctgtcatagatgatgcctgg
tggtttggaacaatcgaaagccaggaacctcttcaacttgagtaccctgatagtctgttt
caatgctacaatgtttgctgggacaatggagatacagaaaagatgagtccttgggatatg
gagcttatacctaataatgctgtatttcctgaagaactaggtaccagtgttcctttaact
gatggtgagtgcagatcactaatctataaacctcttgatggagaatggggtaccaatccc
agggatgaagaatgtgaaagaattgtggcaggaataaaccagttgatgacactagatatt
gcctcagcatttgtggcccccgtggatctgcaagcctatcccatgtattgcacagtagtg
gcatatccaacggatctaagtacaattaaacaaagactggaaaacaggttttacaggcgg
gtttcttccctaatgtgggaagttcgatatatagagcataatacacgaacatttaatgag
cctggaagccctattgtgaaatctgctaaattcgtgactgatcttcttctacattttata
aaggatcagacttgttataacataattccactttataattcaatgaagaagaaagttttg
tctgattctgaggatgaagagaaagatgctgatgtgccaggaacttctactcgaaaaagg
aaggaccatcagcctagaagaagattacgtaatagagcccagtcttacgatattcaagca
tggaagaaacagtgtgaagaattgttaaatctcatatttcaatgtgaagattcagagcct
ttccgtcagccggtagatctccttgaatatccagactacagagacatcattgacactcca
atggattttgctaccgttagagaaactttagaggctgggaattatgagtcaccaatggag
ttatgtaaagatgtcagacttattttcagtaattccaaagcatatacaccaagcaaaaga
tcaaggatttacagcatgagtttgcgcctgtctgctttctttgaagaacacattagttca
gttttatcagattataaatctgctcttcgttttcataaaagaaataccataaccaaaagg
aggaagaaaagaaacagaagcagctctgtttccagtagtgctgcatcaagccctgaaagg
aaaaaaaggatcttaaaaccccagctaaaatcagaaagctctacctctgcattctctaca
cctacacgatcaataccgccaagacacaatgctgctcagataaacggtaaaacagaatct
agttctgtggttcgaaccagaagcaaccgagtggttgtagatccagttgtcactgagcaa
ccatctacttcttcagctgcaaagacttttattacaaaagctaatgcatctgcaatacca
gggaaaacaatactagagaattctgtgaaacattccaaagctttgaatactctttccagt
cctggtcaatccagttttagtcatggcactaggaataattctgcaaaagaaaacatggaa
aaggaaaagccagtcaaacgtaaaatgaagtcatctgtactcccaaaggcgtccactctt
tcaaagtcatcagctgtcattgagcaaggagattgtaagaacaacgctcttgtaccagga
accattcaagtaaatggccatggaggacagccatcaaaacttgtgaagaggggacctgga
aggaaacctaaagtagaagttaataccaatagtggtgaaattatacacaagaaaaggggt
agaaagcccaaaaagctacagtatgcaaagccagaagatttagagcaaaataatgtgcat
cccatcagagatgaagtacttccttcttcaacatgcaattttctttctgaaactaataat
gtaaaggaagatttgttacagaaaaagaatcgtggaggtaggaagcccaaaaggaagatg
aagacacaaaaattagatgcagatctcctagtccctgcaagtgtcaaagtgttaaggaga
agtaaccgaaaaaagatagatgatcctatagatgaggaagaagagtttgaagaactcaaa
ggctctgaaccccacatgagaactagaaatcaaggtcgaaggacagctttctataatgag
gatgactctgaagaggagcaaaggcagctgttgttcgaagacacctctttaacttttgga
acttctagtagaggacgagtccgaaagttgactgaaaaagcaaaagctaatttaattggt
tggtaa

DBGET integrated database retrieval system