KEGG   Homo sapiens (human): 55031Help
Entry
55031             CDS       T01001                                 

Gene name
USP47, TRFP
Definition
ubiquitin specific peptidase 47 (EC:3.4.19.12)
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.3
AA seq 1355 aa AA seqDB search
MVPGEENQLVPKEIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPVRKLFEDVANK
VGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLE
DSSAGEDSVHDRFIGPLPREGSGGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLN
SLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSF
GWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWR
IDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFL
HFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAE
NEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAA
GGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLI
YRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQV
MMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPM
GLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQ
TVTEFKQLISKAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETL
DYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPVSYSKRTAYQKAGGDSGNVDDDCERVK
GPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSAS
VDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIP
LANGLDSHSITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYA
ADEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNET
LSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELI
PQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMK
SMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFP
CDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKES
SRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaagagatagaaaatgctgctgaagaa
cctagagtcttatgtattatacaagatactactaattcaaagacagtgaatgaacggatc
actttaaatttaccagcatctactccagtcagaaagctctttgaagatgtggccaacaaa
gtaggctacataaatggaacctttgacttggtgtggggaaatggaatcaatactgctgat
atggcaccactggatcataccagtgacaagtcacttctcgacgctaattttgagccagga
aagaagaactttctgcatttgacagataaagatggtgaacaacctcaaatactgctggag
gattccagtgctggggaagacagtgttcatgacaggtttataggtccgcttccaagagaa
ggttctgggggttctaccagtgattatgtcagccaaagctactcctactcatctattttg
aataaatcagaaactggatatgtgggactagtaaaccaagcaatgacttgctatttgaat
agccttttgcaaacactttttatgactcctgaatttaggaatgcattatataagtgggaa
tttgaagaatctgaagaagatccagtgacaagtattccataccaacttcaaaggcttttt
gttttgttacaaaccagcaaaaagagagcaattgaaaccacagatgttacaaggagcttt
ggatgggatagtagtgaggcttggcagcagcatgatgtacaagaactatgcagagtcatg
tttgatgctttggaacagaaatggaagcaaacagaacaggctgatcttataaatgagcta
tatcaaggcaagctgaaggactacgtgagatgtctggaatgtggttatgagggctggcga
atcgacacatatcttgatattccattggtcatccgaccttatgggtccagccaagcattt
gctagtgtggaagaagcattgcatgcatttattcagccagagattctggatggcccaaat
cagtatttttgtgaacgttgtaagaagaagtgtgatgcacggaagggccttcggtttttg
cattttccttatctgctgaccttacagctgaaaagattcgattttgattatacaaccatg
cataggattaaactgaatgatcgaatgacatttcccgaggaactagatatgagtactttt
attgatgttgaagatgagaaatctcctcagactgaaagttgcactgacagtggagcagaa
aatgaaggtagttgtcacagtgatcagatgagcaacgatttctccaatgatgatggtgtt
gatgaaggaatctgtcttgaaaccaatagtggaactgaaaagatctcaaaatctggactt
gaaaagaattccttgatctatgaacttttctctgttatggttcattctgggagcgctgct
ggtggtcattattatgcatgtataaagtcattcagtgatgagcagtggtacagcttcaat
gatcaacatgtcagcaggataacacaagaggacattaagaaaacacatggtggatcttca
ggaagcagaggatattattctagtgctttcgcaagttccacaaatgcatatatgctgatc
tatagactgaaggatccagccagaaatgcaaaatttctagaagtggatgaatacccagaa
catattaaaaacttggtgcagaaagagagagagttggaagaacaagaaaagagacaacga
gaaattgagcgcaatacatgcaagataaaattattctgtttgcatcctacaaaacaagta
atgatggaaaataaattggaggttcataaggataagacattaaaggaagcagtagaaatg
gcttataagatgatggatttagaagaggtaatacccctggattgctgtcgccttgttaaa
tatgatgagtttcatgattatctagaacggtcatatgaaggagaagaagatacaccaatg
gggcttctactaggtggcgtcaagtcaacatatatgtttgatctgctgttggagacgaga
aagcctgatcaggttttccaatcttataaacctggagaagtgatggtgaaagttcatgtt
gttgatctaaaggcagaatctgtagctgctcctataactgttcgtgcttacttaaatcag
acagttacagaattcaaacaactgatttcaaaggccatccatttacctgctgaaacaatg
agaatagtgctggaacgctgctacaatgatttgcgtcttctcagtgtctccagtaaaacc
ctgaaagctgaaggattttttagaagtaacaaggtgtttgttgaaagctccgagactttg
gattaccagatggcctttgcagactctcatttatggaaactcctggatcggcatgcaaat
acaatcagattatttgttttgctacctgaacaatccccagtatcttattccaaaaggaca
gcataccagaaagctggaggcgattctggtaatgtggatgatgactgtgaaagagtcaaa
ggacctgtaggaagcctaaagtctgtggaagctattctagaagaaagcactgaaaaactc
aaaagcttgtcactgcagcaacagcaggatggagataatggggacagcagcaaaagtact
gagacaagtgactttgaaaacatcgaatcacctctcaatgagagggactcttcagcatca
gtggataatagagaacttgaacagcatattcagacttctgatccagaaaattttcagtct
gaagaacgatcagactcagatgtgaataatgacaggagtacaagttcagtggacagtgat
attcttagctccagtcatagcagtgatactttgtgcaatgcagacaatgctcagatccct
ttggctaatggacttgactctcacagtatcacaagtagtagaagaacgaaagcaaatgaa
gggaaaaaagaaacatgggatacagcagaagaagactctggaactgatagtgaatatgat
gagagtggcaagagtaggggagaaatgcagtacatgtatttcaaagctgaaccttatgct
gcagatgaaggttctggggaaggacataaatggttgatggtgcatgttgataaaagaatt
actctggcagctttcaaacaacatttagagccctttgttggagttttgtcctctcacttc
aaggtctttcgagtgtatgccagcaatcaagagtttgagagcgtccggctgaatgagaca
ctttcatcattttctgatgacaataagattacaattagactggggagagcacttaaaaaa
ggagaatacagagttaaagtataccagcttttggtcaatgaacaagagccatgcaagttt
ctgctagatgctgtgtttgctaaaggaatgactgtacggcaatcaaaagaggaattaatt
cctcagctcagggagcaatgtggtttagagctcagtattgacaggtttcgtctaaggaaa
aaaacatggaagaatcctggcactgtctttttggattatcatatttatgaagaagatatt
aatatttccagcaactgggaggttttccttgaagttcttgatggggtagagaagatgaag
tccatgtcacagcttgcagttttgtcaagacggtggaagccttcagagatgaagttggat
cccttccaggaggttgtattggaaagcagtagtgtggacgaattgcgagagaagcttagt
gaaatcagtgggattcctttggatgatattgaatttgctaagggtagaggaacatttccc
tgtgatatttctgtccttgatattcatcaggatttagactggaatcctaaagtttctacc
ctgaatgtctggcctctttatatctgtgatgatggtgcggtcatattttatagggataaa
acagaagaattaatggaattgacagatgagcaaagaaatgaactgatgaaaaaagaaagc
agtcgactccagaagactggacatcgtgtaacatactcacctcgtaaagagaaagcacta
aaaatatatctggatggagcaccaaataaagatctgactcaagactga

DBGET integrated database retrieval system