KEGG   Homo sapiens (human): 5506Help
Entry
5506              CDS       T01001                                 

Gene name
PPP1R3A, GM, PP1G, PPP1R3
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 3A
  KO
K07189  
protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5506 (PPP1R3A)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5506 (PPP1R3A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5506 (PPP1R3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16821(Tbio)
UniProt: 
Position
7q31.1
AA seq 1122 aa AA seqDB search
MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSG
TRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLM
QQLQIQKAILESTESLLGSTSIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNS
CDGETDQFSFKIVLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTFICQKKEQEPEP
VKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNTDTYIPTIICSHEDKEDLEAS
NRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFPNKAEGLEKKQ
IHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVK
DLGCLRRDFHSDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHD
QERKMGNPKISVAGIGASNRDLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEH
HHLTSEGSALGGITGQVCSSRTGNVLRNDYLFQVEEKSGGINSEDQDNSPQHKQSWNVLE
SQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTEELFTCQETVCCELSSLADHG
ITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKETAFDPHEGRN
DDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHS
AFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREI
QGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLEN
MEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFSKYTNSKIPYFL
LFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVKKK
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atggagccttctgaagtacctagtcagattagcaaagataattttttagaagttcctaat
ttatctgactctctttgtgaagatgaagaagttactttccaacctggtttctcccctcaa
ccaagtagacgaggttctgattcttctgaagacatatacctggataccccatcttcaggt
actagaagagtttcatttgctgattcctttggattcaatcttgtgtctgttaaagaattt
gattgctgggaattaccgagtgcttcaaccacttttgacttagggacggacattttccac
acagaagaatatgttttagccccactgtttgacttgccttcttcaaaagaagatcttatg
caacaactccaaatacagaaagcaatactggagtcaactgagtctcttcttgggtctaca
agtatcaagggtattattcgagttttgaatgtttcttttgagaagttagtatatgtaaga
atgtctttagatgactggcagacacattatgacattttagcagaatatgttcctaattca
tgtgatggtgaaactgaccagttctcctttaagattgtattggttcctccttatcaaaaa
gatggcagtaaagttgagttttgtatacgttatgaaacttctgttggtacattttggtca
aataataatggcacaaattatacattcatttgtcaaaagaaagaacaagagccggagcct
gtaaaaccatggaaagaagttcctaacagacaaataaaaggctgcttaaaggtaaaatca
agtaaagaagaatcatcagtaacatcagaagaaaataactttgagaatccaaagaataca
gatacctatatcccaacaatcatttgttctcatgaggacaaggaagatttggaagccagt
aatcgaaatgtaaaagatgtaaacagggaacatgatgaacataatgaaaaagaattagag
ttgatgataaatcaacacttaataagaaccagaagtactgcttccagagatgaaaggaat
acattttcaacagatccagtcaattttccaaataaagcagaggggttagagaagaagcaa
atccatggtgaaatatgtactgacttgttccaaaggtctctgtctccaagttcatcagca
gaaagctccgtaaagggagatttttactgcaatgaaaaatattcctcaggagatgactgt
acacatcaaccttcagaggaaactacttcaaatatgggagaaatcaagccatcattggga
gatactagtagtgatgaactagtgcaattacatactggcagcaaagaagtcctggatgat
aatgctaatccagcccatggcaatggcacagtgcaaataccttgcccctcttcagatcaa
ctaatggcaggaaaccttaataaaaaacatgaaggaggagctaaaaatattgaagtaaaa
gatttgggatgtttacgaagagatttccattcagatacgtcggcatgtctcaaagaatca
acagaagaaggatcttctaaggaagattattatggcaatggtaaggatgatgaagaacaa
agaatatatttaggtgttaatgaaaaacaaagaaaaaatttccaaacaatcttacatgac
caagaaaggaagatgggtaaccctaaaataagtgtggcagggattggagctagtaacaga
gacctggctactctgctgagcgaacataccgcaatccccacccgggcaatcacagcagat
gtgtctcattcaccaaggacaaatttaagttgggaagaagctgtgttaaccccagagcat
catcatttgactagtgaaggcagcgctttaggagggataactggtcaagtttgttcatca
agaactggaaatgttttgaggaatgattatcttttccaagttgaagaaaaatcaggtggg
attaattctgaagatcaggataatagcccacagcataaacaaagttggaatgttctggaa
agtcagggaaaatcaagagagaataagacaaacataacagagcatatcaaaggacaaaca
gattgtgaagacgtgtggggaaaaagagataatacgaggagtttgaaagctactacagaa
gaattgtttacctgccaagaaacagtgtgctgtgaactgtcttctctagctgatcatggc
attactgagaaagcagaagctggtacagcctatataattaagacaacatcagaaagtact
ccagaaagcatgtctgctagagaaaaagcaataattgctaagctacctcaagagacagca
cgaagtgacaggcccatcgaggtaaaggaaacagcgtttgatccacatgaagggagaaat
gatgattcacattataccctttgtcaacgagatacagtaggtgtaatctatgacaatgat
tttgaaaaggaatcacgtttaggtatttgtaatgtacgtgtagatgaaatggagaaggaa
gaaaccatgtctatgtacaatcctaggaagacacatgacagggagaaatgtggcactgga
aatataacatctgtggaagaatcctcatgggtcattacagaatatcaaaaagcaacttca
aaactggatttacagttgggaatgttaccaacagacaaaactgtattttcagaaaacaga
gatcttaggcaggttcaagaattatcaaagaaaacagactcggatgccattgtgcattct
gcttttaactcagacactaatagagctcctcagaatagctctcctttttccaaacatcat
actgaaatttcagtgtcaactaatgagcaggcaattgctgtagagaatgcagttactacc
atggctagccaacctatttctacgaaatcagaaaatatttgtaattcaacaagagaaatc
cagggtattgagaagcacccttatcctgagtctaaacctgaagaagtttccagaagttca
ggaatagtgacatcaggtagtagaaaagaaagatgcataggccagattttccaaacagaa
gagtatagtgtggaaaaatctctagggccaatgattttaatcaacaaacctcttgagaat
atggaagaagcaaggcatgaaaatgaaggattagtaagctctgggcaatcactatacact
tcaggtgaaaaggaatctgacagctctgcttctactagtcttcctgttgaggaaagtcaa
gctcaaggcaacgaatctttgttttcaaaatataccaactctaaaataccttatttcctt
ttgtttctgatatttcttataactgtctaccattatgacttaatgattggcttgacattc
tacgttttgtcattgtcctggctatcctgggaagagggtagacaaaaagagtctgtcaaa
aagaagtaa

DBGET integrated database retrieval system