KEGG   Homo sapiens (human): 55063Help
Entry
55063             CDS       T01001                                 

Gene name
ZCWPW1, ZCW1
Definition
zinc finger, CW type with PWWP domain 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 524 aa AA seqDB search
MMTTLQNKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASL
KKKEEKATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKSLQECL
GMGSGLDFAETSCAQPVVSTQSDKEPGITASATDTDNANGEEVPHTQEISVSWEGEAAPE
IRTSKLGQPDPAPSKKKSNRLTLSKRKKEAQDEKVEKTQGGHEHRQEDRLKKTVQDHSQI
RDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIP
EETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYH
VTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQER
VNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTALRKNLKLP
RARPWQPAFQREKKLEQCQRTWAYQRVRGPAPHLRKKSPDTGNP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaacgttgcagaataaagaagaatgtggaaagggaccaaagagaatctttgcc
ccacctgcacaaaaatcttacagcctgttaccttgtagccctaactcccctaaggaggag
accccggggatcagttccccagagacagaggccaggataagcctgccaaaggccagttta
aagaagaaagaggaaaaagcaaccatgaagaatgttccaagcagggaacaggagaaaaaa
agaaaggcacaaatcaacaagcaagcagagaagaaagaaaaggaaaaatcaagtcttacc
aatgcagaatttgaggagattgtccagattgttctgcagaagtcccttcaggagtgcttg
gggatgggatctggccttgattttgcagagacttcttgtgcccagcccgtagtatctacc
caatcagacaaggagccaggaattactgcttctgctactgatactgataatgctaatgga
gaggaggtaccacatactcaagagatttcagtgtcttgggaaggtgaagctgcccctgag
ataaggacatctaagttaggccagccagatcctgcaccctctaagaagaaatccaataga
ctcaccttaagcaaaagaaagaaggaagctcaagatgagaaggtggagaaaactcaaggt
ggacatgagcacagacaggaagaccgactaaagaaaacagttcaggatcattctcagatc
agggaccagcaaaaaggagagataagtggttttggtcaatgtctggtctgggtccagtgt
tccttcccaaactgtgggaaatggaggcggctgtgtgggaacattgacccctcagttctc
ccagataattggtcctgtgatcagaacacagatgtgcagtataatcgctgtgatattcct
gaggagacctggacagggcttgagagtgatgtggcctatgcctcctacatcccaggatcc
atcatctgggccaagcaatacggttacccctggtggccaggcatgatagaatctgatcct
gacttaggggaatattttctttttacttcccatcttgattccctgccgtctaagtaccat
gtgacgttttttggagaaacagtttctcgtgcatggatcccagtcaacatgctaaagaac
ttccaggagctgtccctggagctatcagtcatgaaaaagcgcagaaatgactgcagccag
aaactgggggtggccctgatgatggctcaagaggcagaacagatcagcattcaggaacgg
gttaacttgtttggtttctggagccgattcaacggatctaacagtaatggggaaagaaaa
gacttacagctctctggtttgaacagcccaggatcctgcttagagaaaaaggagaaagag
gaagagttggaaaaggaggaaggagagaaaacagccctaagaaaaaatttaaagctcccc
agagcaaggccttggcagccagcttttcagagggaaaagaagttagaacagtgccaaaga
acctgggcctatcagcgtgtaagggggcctgcccctcatctgcgaaagaagagcccagac
accgggaacccctga

DBGET integrated database retrieval system