KEGG   Homo sapiens (human): 55063Help
Entry
55063             CDS       T01001                                 

Gene name
ZCWPW1, ZCW1
Definition
(RefSeq) zinc finger CW-type and PWWP domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 648 aa AA seqDB search
MMTTLQNKEECGKGPKRIFAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASL
KKKEEKATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKSLQECL
GMGSGLDFAETSCAQPVVSTQSDKEPGITASATDTDNANGEEVPHTQEISVSWEGEAAPE
IRTSKLGQPDPAPSKKKSNRLTLSKRKKEAHEKVEKTQGGHEHRQEDRLKKTVQDHSQIR
DQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPE
ETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHV
TFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERV
NLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRV
KIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPPAPRMGRKEGQGNSDSDQ
PGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAG
SVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaacgttgcagaataaagaagaatgtggaaagggaccaaagagaatctttgcc
ccacctgcacaaaaatcttacagcctgttaccttgtagccctaactcccctaaggaggag
accccggggatcagttccccagagacagaggccaggataagcctgccaaaggccagttta
aagaagaaagaggaaaaagcaaccatgaagaatgttccaagcagggaacaggagaaaaaa
agaaaggcacaaatcaacaagcaagcagagaagaaagaaaaggaaaaatcaagtcttacc
aatgcagaatttgaggagattgtccagattgttctgcagaagtcccttcaggagtgcttg
gggatgggatctggccttgattttgcagagacttcttgtgcccagcccgtagtatctacc
caatcagacaaggagccaggaattactgcttctgctactgatactgataatgctaatgga
gaggaggtaccacatactcaagagatttcagtgtcttgggaaggtgaagctgcccctgag
ataaggacatctaagttaggccagccagatcctgcaccctctaagaagaaatccaataga
ctcaccttaagcaaaagaaagaaggaagctcatgagaaggtggagaaaactcaaggtgga
catgagcacagacaggaagaccgactaaagaaaacagttcaggatcattctcagatcagg
gaccagcaaaaaggagagataagtggttttggtcaatgtctggtctgggtccagtgttcc
ttcccaaactgtgggaaatggaggcggctgtgtgggaacattgacccctcagttctccca
gataattggtcctgtgatcagaacacagatgtgcagtataatcgctgtgatattcctgag
gagacctggacagggcttgagagtgatgtggcctatgcctcctacatcccaggatccatc
atctgggccaagcaatacggttacccctggtggccaggcatgatagaatctgatcctgac
ttaggggaatattttctttttacttcccatcttgattccctgccgtctaagtaccatgtg
acgttttttggagaaacagtttctcgtgcatggatcccagtcaacatgctaaagaacttc
caggagctgtccctggagctatcagtcatgaaaaagcgcagaaatgactgcagccagaaa
ctgggggtggccctgatgatggctcaagaggcagaacagatcagcattcaggaacgggtt
aacttgtttggtttctggagccgattcaacggatctaacagtaatggggaaagaaaagac
ttacagctctctggtttgaacagcccaggatcctgcttagagaaaaaggagaaagaggaa
gagttggaaaaggaggaaggagagaaaacagacccaattttgcccattcgtaagcgagtc
aaaatacagacccaaaaaaccaagccaagagggcttgggggtgatgcaggcacagcagat
ggccgaggcaggacactgcagaggaagataatgaagagatctctaggcaggaaatccaca
gctcctcctgcacccagaatgggaaggaaagaaggccaagggaattcagattctgaccag
ccaggccctaagaaaaaatttaaagctccccagagcaaggccttggcagccagcttttca
gagggaaaagaagttagaacagtgccaaagaacctgggcctatcagcgtgtaagggggcc
tgcccctcatctgcgaaagaagagcccagacaccgggaacccctgacccaggaggctgga
agtgtcccccttgaggacgaagcctccagtgacctggacctggagcaactcatggaagat
gttgggagagagctggggcagagcggggagctgcagcacagcaacagtgatggcgaggac
ttccccgtggcgctgtttgggaagtag

DBGET integrated database retrieval system