KEGG   Homo sapiens (human): 5507Help
Entry
5507              CDS       T01001                                 

Gene name
PPP1R3C, PPP1R5
Definition
protein phosphatase 1, regulatory subunit 3C
Orthology
K07189  
protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Class
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23-q24
AA seq 317 aa AA seqDB search
MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKS
CLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLN
DISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSF
EKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA
NGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL
FPEWQSWGRMENLASYR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaccagaatgatccaggttttagatccacgtcctttgacaagttcggtcatg
cccgtggatgtggccatgaggctttgcttggcacattcaccacctgtgaagagtttcctg
ggcccgtacgatgaatttcaacgacgacattttgtgaataaattaaagcccctgaaatca
tgtctcaatataaaacacaaagccaaatcacagaatgactggaagtgctcacacaaccaa
gccaagaagcgcgttgtgtttgctgactccaagggcctctctctcactgcgatccatgtc
ttctccgacctcccagaagaaccagcgtgggatctgcagtttgatctcttggaccttaat
gatatctcctctgccttaaaacaccacgaggagaaaaacttgattttagatttccctcag
ccttcaaccgattacttaagtttccggagccactttcagaagaactttgtctgtctggag
aactgctcgttgcaagagcgaacagtgacagggactgttaaagtcaaaaatgtgagtttt
gagaagaaagttcagatccgtatcactttcgattcttggaaaaactacactgacgtagac
tgtgtctatatgaaaaatgtgtatggtggcacagatagtgataccttctcatttgccatt
gacttaccccctgtcattccaactgagcagaaaattgagttctgcatttcttaccatgct
aatgggcaagtcttttgggacaacaatgatggtcagaattatagaattgttcatgttcaa
tggaagcctgatggggtgcagacacagatggcaccccaggactgtgcattccaccagacg
tctcctaagacagagttagagtcaacaatctttggcagtccgaggctggctagtgggctc
ttcccagagtggcagagctgggggagaatggagaacttggcctcttatcgatga

DBGET integrated database retrieval system