KEGG   Homo sapiens (human): 55070Help
Entry
55070             CDS       T01001                                 

Gene name
DET1
Definition
de-etiolated homolog 1 (Arabidopsis)
Orthology
K10571  
de-etiolated-1
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q25.3
AA seq 550 aa AA seqDB search
MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcatgtttctaccatcaagcctcgaagaatccaaaaccaaaatgtcattcac
cgcttggaacgccggcggatcagttcaggcaaggcaggtacccactggcaccaagtccga
gtgttccatcagaatgtcttccccaacttcacagttgtcaacgttgaaaagcctccttgt
ttcttgcgtaaattctcacctgatggacgctactttattgctttttcttcagaccagaca
tctcttgaaatctatgagtaccagggctgccaggcagcagaggacctactgcagggatac
gaaggagaaatcctgtccaatggcaatgaccagcggtcagtgaatatccggggccggctc
tttgaacgcttttttgtcctgctgcacattaccaatgttgcggccaatggtgagcacctg
aaccgggagtgtagtctcttcactgatgactgccgctgtgtcatcgtgggctcagctgcc
tacctcccagatgagcctcaccctccattttttgaggtatatcggaacagtgaatcagtg
acccccaacccacggtcccctctagaagactattccctccatatcattgaccttcacacc
ggccgcttatgtgatacacgcacgttcaagtgtgacaaggtggtcttgtcacacaaccaa
gggctgtacttgtacaaaaacatcctggccatcttgtctgtgcaacaacagaccatccat
gtcttccaggtgactcctgaaggcactttcattgatgtgcggaccattggccgcttttgc
tatgaggatgacctgctcactgtgtcagctgttttccctgaggtacagcgggacagtcag
acaggcatggccaatccctttagggatcctttcatcaattccctcaaacaccggttgctg
gtatatttgtggcgccgggcagaacaggatggtagtgcaatggccaagaggcgcttcttc
cagtattttgaccaactgcggcagctgcgaatgtggaaaatgcagcttctggatgaaaac
cacctgtttatcaagtacactagtgaggatgtagtaacactgcgagtcacagatccatca
caggcatctttctttgtggtgtacaatatggtgacgacagaggtgattgctgtgtttgag
aatacatcagatgagcttttggagctctttgagaacttctgtgacctttttcgtaatgct
accctgcacagtgaagttcagtttccctgctcagcttctagcaacaattttgcaaggcag
atccagcgccggttcaaagacactattataaatgccaagtatggagggcacacagaggca
gtacgccggctgctgggtcagctccccatcagtgctcagtcttacagcggtagcccctat
ctggatttgtctctcttcagttatgatgacaagtgggtatctgtcatggagcggcccaag
acttgtggagatcacccaatcaggttctatgcccgggactcgggcctgctcaagtttgag
atccaggcggggttattgggccgccccatcaaccacacagtgcgacgccttgttgccttc
acctttcacccttttgagcctttcgctatttctgtgcagaggactaatgctgagtatgtt
gtcaacttccatatgcgacactgctgcacgtag

DBGET integrated database retrieval system