KEGG   Homo sapiens (human): 5511Help
Entry
5511              CDS       T01001                                 

Gene name
PPP1R8, ARD-1, ARD1, NIPP-1, NIPP1, PRO2047
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 8
  KO
K13216  
nuclear inhibitor of protein phosphatase 1 [EC:3.1.4.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     5511 (PPP1R8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5511 (PPP1R8)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    5511 (PPP1R8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35.3
AA seq 351 aa AA seqDB search
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDF
TIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGAS
TRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTL
TIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEG
PGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPD
VDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccgcgaactccggctctagcctcccgctgttcgactgcccaacctgggca
ggtaagccccctcccggtttacatctggatgtagtcaaaggagacaaactaattgagaaa
ctgattattgatgagaagaagtattacttatttgggagaaaccctgatttgtgtgacttt
accattgaccaccagtcttgctctcgggtccatgctgcacttgtctaccacaagcatctg
aagagagttttcctgatagatctcaacagtacacacggcactttcttgggtcacattcgg
ttggaacctcacaagcctcagcaaattcccatcgattccacggtctcatttggcgcatcc
acaagggcatacactctgcgcgagaagcctcagacattgccatcggctgtgaaaggagat
gagaagatgggtggagaggatgatgaactcaagggcttactggggcttccagaggaggaa
actgagcttgataacctgacagagttcaacactgcccacaacaagcggatttctaccctt
accattgaggagggaaatctggacattcaaagaccaaagaggaagaggaagaactcacgg
gtgacattcagtgaggatgatgagatcatcaacccagaggatgtggatccctcagttggt
cgattcaggaacatggtgcaaactgcagtggtcccagtcaagaagaagcgtgtggagggc
cctggctccctgggcctggaggaatcagggagcaggcgcatgcagaactttgccttcagc
ggaggactctacgggggcctgccccccacacacagtgaagcaggctcccagccacatggc
atccatgggacagcactcatcggtggcttgcccatgccatacccaaaccttgcccctgat
gtggacttgactcctgttgtgccgtcagcagtgaacatgaaccctgcaccaaaccctgca
gtctataaccctgaagctgtaaatgaacccaagaagaagaaatatgcaaaagaggcttgg
ccaggcaagaagcccacaccttccttgctgatttga

DBGET integrated database retrieval system