KEGG   Homo sapiens (human): 55124Help
Entry
55124             CDS       T01001                                 

Gene name
PIWIL2, CT80, HILI, PIWIL1L, mili
Definition
(RefSeq) piwi like RNA-mediated gene silencing 2
  KO
K02156  
aubergine
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    55124 (PIWIL2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    55124 (PIWIL2)
   piRNA pathway
    55124 (PIWIL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21.3
AA seq 973 aa AA seqDB search
MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQ
RGPAQRESVGLVSMFRGLGIETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTF
WDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRG
PPQLSSPPALPQSPLHSPDRPLVLTVEHKEKELIVKQGSKGTPQSLGLNLVKIQCHNEAV
YQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSA
EISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIW
PGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVIT
RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ
DNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIA
KNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILT
IPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTL
GAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQ
INCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMP
HQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAF
ENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGC
GIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHH
EPAIQLCENLFFL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggatcctttccgaccatcgttcaggggccagtctcctatccacccatcccagtgccag
gctgtacggatgccaggctgttggccacaagcttctaaacctttggacccagctctgggc
aggggagcacctgcaggcagaggccatgtatttggaaagccagaggaaccaagcacacag
agggggccagcacaaagggagtctgtgggtttggtctccatgttccgaggcctgggcatt
gaaacagtttctaagacccctctgaaacgggaaatgcttccatcaggtagaggcatttta
ggtcgaggcttgtctgctaatctggtacgcaaggacagggaggaactctctcccactttt
tgggatccaaaagtgttggcggctggggacagcaagatggcagagacctccgttggttgg
agtaggacgcttggaagagggagttcagatgcgtctttattaccactgggaagagcagca
ggtggtatcagcagagaagtggacaagcctccctgtaccttcagcacaccgtcccggggt
cccccgcagctgtcatcaccaccagctctgccccagtctcccctgcactctccagatcgc
cctctggtcctgactgtggaacacaaggaaaaagagcttattgtgaagcaaggatcaaaa
ggaacacctcagtctttgggactgaacctcgtcaaaatacagtgtcataatgaagcagtt
tatcaatatcatgtgactttcagccccaatgtggagtgcaaaagcatgaggttcggcatg
ttgaaggaccatcaagctgtcaccggcaacgtcactgcgtttgatggatctattctctat
ctgcctgttaagcttcaacaagttcttgagttaaaaagtcaaaggaaaacagacagtgct
gaaatcagcattaagattcagatgacaaagatcctggagccctgctctgacctgtgcatt
cccttctacaatgttgttttccgtcgggtaatgaaacttttagatatgaagcttgtgggg
agaaacttttatgaccctacaagtgctatggtactacagcaacacagattgcagatctgg
ccaggctatgcagctagcatccgaaggacagatggagggctcttcctgctagctgatgtc
tcccataaggtcattcggaatgactgtgtgctggatgtcatgcatgccatttatcagcag
aataaagaacacttccaggatgagtgtactaagcttctggttggcaatattgttatcacc
cgatataacaatcgtacctatcgtattgatgatgtggattggaataagactccaaaggat
agcttcacgatgtctgatgggaaagagatcacattcttggaatactacagcaaaaattat
gggatcacagttaaggaagaggaccagccattgctgattcacaggcccagtgagagacag
gataatcatgggatgctgctaaaaggggaaatcctgctgctgcctgagctttcttttatg
accggaatcccagagaagatgaagaaggacttcagagccatgaaggatttggctcagcaa
atcaatctgagccccaagcaacaccatagtgctttggaatgcttgctgcaaagaattgca
aagaacgaggcagccaccaatgaactgatgcgttgggggctccgtctgcaaaaggatgta
cataagattgaaggacgtgttctgccaatggaaagaattaacttaaaaaatacttcgttt
atcacatctcaggaactaaactgggttaaggaagtaaccagagacccttccatcttgact
atccccatgcatttctgggcacttttttacccaaagagagcaatggaccaggctcgagaa
ctggtcaacatgttggagaagatagccggccccattggcatgcgtatgagcccaccggcc
tgggttgaactaaaggatgaccgaatagagacttatgtcagaaccattcaatccacgtta
ggagctgaggggaagatacagatggttgtttgcatcatcatgggcccacgtgatgatctc
tatggggccatcaagaagctgtgctgtgtgcagtccccagtgccctcccaggttgtcaat
gttcgaaccattggtcagcccaccaggcttcggagtgtggcccagaagattttacttcag
attaactgtaaattgggtggtgagctctggggagtggatattcctctgaaacagttaatg
gtgatcgggatggatgtttaccatgaccccagtagaggcatgcgctccgtggttggcttc
gtggcaagcatcaatctcaccctcacaaaatggtattcccgggtggtgttccagatgccg
catcaggagattgtggacagcctgaagctatgcctcgtgggctccttaaaaaagttttat
gaggtgaaccactgtctaccagagaagattgtggtgtaccgtgatggagtgtctgatggc
caactgaagacagttgccaactatgagattcctcaactacagaagtgttttgaagctttt
gagaattatcagcccaagatggtggtgtttgtagttcagaagaaaatcagtactaatcta
tatctggctgctcctcagaactttgtaactcccactcctggaactgtggtagatcataca
ataacaagctgtgagtgggtggatttctatcttcttgcccatcatgtacggcagggctgt
ggcattcctacgcattatgtctgtgttctcaacaccgcaaacctgagccctgatcatatg
cagaggctgactttcaaactgtgccacatgtactggaattggcctggcaccatcagagtt
ccagctccttgcaagtatgcccacaagctagctttcctgtcaggacacatcttgcatcat
gaaccagccatccagctgtgcgagaacctgttcttcctgtga

DBGET integrated database retrieval system