KEGG   Homo sapiens (human): 55127Help
Entry
55127             CDS       T01001                                 

Gene name
HEATR1, BAP28, UTP10
Definition
HEAT repeat containing 1
Orthology
K14550  
U3 small nucleolar RNA-associated protein 10
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q43
AA seq 2144 aa AA seqDB search
MTSLAQQLQRLALPQSDASLLSRDEVASLLFDPKEAATIDRDTAFAIGCTGLEELLGIDP
SFEQFEAPLFSQLAKTLERSVQTKAVNKQLDENISLFLIHLSPYFLLKPAQKCLEWLIHR
FHIHLYNQDSLIACVLPYHETRIFVRVIQLLKINNSKHRWFWLLPVKQSGVPLAKGTLIT
HCYKDLGFMDFICSLVTKSVKVFAEYPGSSAQLRVLLAFYASTIVSALVAAEDVSDNIIA
KLFPYIQKGLKSSLPDYRAATYMIICQISVKVTMENTFVNSLASQIIKTLTKIPSLIKDG
LSCLIVLLQRQKPESLGKKPFPHLCNVPDLITILHGISETYDVSPLLHYMLPHLVVSIIH
HVTGEETEGMDGQIYKRHLEAILTKISLKNNLDHLLASLLFEEYISYSSQEEMDSNKVSL
LNEQFLPLIRLLESKYPRTLDVVLEEHLKEIADLKKQELFHQFVSLSTSGGKYQFLADSD
TSLMLSLNHPLAPVRILAMNHLKKIMKTSKEGVDESFIKEAVLARLGDDNIDVVLSAISA
FEIFKEHFSSEVTISNLLNLFQRAELSKNGEWYEVLKIAADILIKEEILSENDQLSNQVV
VCLLPFMVINNDDTESAEMKIAIYLSKSGICSLHPLLRGWEEALENVIKSTKPGKLIGVA
NQKMIELLADNINLGDPSSMLKMVEDLISVGEEESFNLKQKVTFHVILSVLVSCCSSLKE
THFPFAIRVFSLLQKKIKKLESVITAVEIPSEWHIELMLDRGIPVELWAHYVEELNSTQR
VAVEDSVFLVFSLKKFIYALKAPKSFPKGDIWWNPEQLKEDSRDYLHLLIGLFEMMLNGA
DAVHFRVLMKLFIKVHLEDVFQLFKFCSVLWTYGSSLSNPLNCSVKTVLQTQALYVGCAM
LSSQKTQCKHQLASISSPVVTSLLINLGSPVKEVRRAAIQCLQALSGVASPFYLIIDHLI
SKAEEITSDAAYVIQDLATLFEELQREKKLKSHQKLSETLKNLLSCVYSCPSYIAKDLMK
VLQGVNGEMVLSQLLPMAEQLLEKIQKEPTAVLKDEAMVLHLTLGKYNEFSVSLLNEDPK
SLDIFIKAVHTTKELYAGMPTIQITALEKITKPFFAAISDEKVQQKLLRMLFDLLVNCKN
SHCAQTVSSVFKGISVNAEQVRIELEPPDKAKPLGTVQQKRRQKMQQKKSQDLESVQEVG
GSYWQRVTLILELLQHKKKLRSPQILVPTLFNLLSRCLEPLPQEQGNMEYTKQLILSCLL
NICQKLSPDGGKIPKDILDEEKFNVELIVQCIRLSEMPQTHHHALLLLGTVAGIFPDKVL
HNIMSIFTFMGANVMRLDDTYSFQVINKTVKMVIPALIQSDSGDSIEVSRNVEEIVVKII
SVFVDALPHVPEHRRLPILVQLVDTLGAEKFLWILLILLFEQYVTKTVLAAAYGEKDAIL
EADTEFWFSVCCEFSVQHQIQSLMNILQYLLKLPEEKEETIPKAVSFNKSESQEEMLQVF
NVETHTSKQLRHFKFLSVSFMSQLLSSNNFLKKVVESGGPEILKGLEERLLETVLGYISA
VAQSMERNADKLTVKFWRALLSKAYDLLDKVNALLPTETFIPVIRGLVGNPLPSVRRKAL
DLLNNKLQQNISWKKTIVTRFLKLVPDLLAIVQRKKKEGEEEQAINRQTALYTLKLLCKN
FGAENPDPFVPVLNTAVKLIAPERKEEKNVLGSALLCIAEVTSTLEALAIPQLPSLMPSL
LTTMKNTSELVSSEVYLLSALAALQKVVETLPHFISPYLEGILSQVIHLEKITSEMGSAS
QANIRLTSLKKTLATTLAPRVLLPAIKKTYKQIEKNWKNHMGPFMSILQEHIGVMKKEEL
TSHQSQLTAFFLEALDFRAQHSENDLEEVGKTENCIIDCLVAMVVKLSEVTFRPLFFKLF
DWAKTEDAPKDRLLTFYNLADCIAEKLKGLFTLFAGHLVKPFADTLNQVNISKTDEAFFD
SENDPEKCCLLLQFILNCLYKIFLFDTQHFISKERAEALMMPLVDQLENRLGGEEKFQER
VTKHLIPCIAQFSVAMADDSLWKPLNYQILLKTRDSSPKVRFAALITVLALAEKLKENYI
VLLPESIPFLAELMEDECEEVEHQCQKTIQQLETVLGEPLQSYF
NT seq 6435 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccttagcccagcagctgcaacgactcgccctccctcaaagtgatgccagcctc
ttatctagagatgaagttgcttctttgttatttgaccctaaggaagcggccacaatcgac
agggacaccgccttcgccattggatgtactggcctggaagagttgcttggaattgatcct
tcctttgagcagtttgaagcaccgttgttcagtcagctagcaaaaaccttggagcgaagt
gttcagaccaaagcagtaaacaaacagttggatgaaaacatttcattattccttattcac
ttgtcgccttacttcctgcttaagccagcacagaagtgtctggagtggttgattcacagg
ttccatatacatctctataatcaagatagcctcattgcttgtgttctgccataccacgag
acaagaatatttgtgcgagtcatacagcttctaaaaattaataattcaaagcacagatgg
ttctggttgttgccagttaagcaatctggagtgccgttagctaaaggaactttgattacc
cactgctacaaagatcttggattcatggatttcatttgcagtttggtgacaaaatctgtg
aaggtttttgctgagtacccgggcagctcagctcagttgagggtgctcttggctttctat
gcttctaccatagtgtcggcgctggtagctgcagaggacgtatcagacaatatcatcgcc
aaactatttccctatatccaaaagggattgaaatcatctttaccagattacagagctgca
acatacatgataatatgtcagatttctgtgaaagtgaccatggaaaatacctttgtgaat
tcattggcatcacagatcatcaaaacattgaccaagattccctctttgatcaaggatggg
ttaagttgcttgatagtgctcctgcagagacagaagccagagagccttgggaaaaagcca
ttccctcacttatgtaatgttcctgatcttattacaatacttcatgggatttctgaaact
tacgatgtcagtcctcttctgcattacatgcttccccatctggtcgtctccatcattcat
catgttacaggagaagaaactgaaggaatggatggtcaaatctacaagagacacttagaa
gctatacttacaaaaatatcactgaagaacaacttagaccatttgttggctagccttcta
tttgaagagtatatttcatatagttcacaggaagaaatggattctaataaagtgtctttg
cttaatgaacaatttcttccactcattaggcttttagaaagcaaataccccagaacatta
gatgttgtattagaggaacacttaaaggaaattgcagatctgaaaaaacaagagcttttc
catcagtttgtttctctttctacaagtggaggaaagtatcagtttttagcagattctgat
acttctttgatgctcagcctgaatcatccacttgctcctgtgagaattctggccatgaat
catttgaaaaagatcatgaaaacatcaaaggagggtgttgatgaatctttcataaaagaa
gctgttttagcccgattaggtgatgataatatagatgttgttttgtcggctataagtgct
tttgagattttcaaagaacacttcagttcagaagtgacgatttcaaatcttctgaatctc
tttcaaagagcagaactttcaaagaatggagaatggtacgaggtacttaagatagccgct
gacatattaattaaagaagagatactgagtgaaaatgatcagttgtcaaatcaggtggtt
gtatgtttgctgccatttatggttatcaataatgatgatacggaatctgctgagatgaaa
attgctatatatttatcaaaatcaggaatctgctccctgcaccctctattaagaggctgg
gaagaagctcttgaaaatgtaattaaaagcacaaagccaggaaaactaatcggtgtagca
aatcagaagatgattgagttgttggctgataatataaatttaggagatccttcttcaatg
ttaaagatggtggaggatttaataagcgtgggtgaggaggagtcctttaacctgaagcag
aaagtaacgtttcatgtgatcctgtctgtgctcgtctcttgttgttcatctttaaaagaa
acccactttccatttgcgataagagtcttcagtttgttgcagaaaaaaataaagaagctt
gaaagtgtcattactgcagtggaaatcccctcagaatggcacattgaactgatgttagac
agagggatcccagtggagctgtgggcacattatgtagaagagctcaacagcactcagagg
gtggccgtggaggactcggtttttcttgtattttccttgaaaaaatttatttatgcactg
aaagctcctaaatcttttcctaaaggtgatatatggtggaatcctgaacaactgaaagaa
gacagcagggactatctgcacttgctcattgggctgtttgagatgatgctcaatggtgcc
gatgctgttcatttcagagttctgatgaaacttttcataaaggtgcatctagaagatgtt
tttcagttattcaagttctgttctgttttatggacctatggttctagcctttcaaatcca
ctaaactgcagtgtgaaaacagtgctgcagactcaagctctttatgtgggctgtgcaatg
ctttcttctcagaagacacagtgtaaacaccaactggcatccatatcttctccagtggtg
acatctttactcattaacctgggaagccccgtaaaagaagttcgtagggctgccattcag
tgtctccaggccctcagtggagtggcatccccgttttatctgataatagatcatttgatt
tctaaagcagaggagatcacttcagatgctgcctatgttattcaggatttggctacttta
tttgaggaactacagagagaaaagaaactgaaatctcatcagaagttgtctgaaactttg
aaaaacttacttagttgtgtgtatagttgcccatcttatatagcaaaagatttgatgaaa
gtacttcagggagtcaacggtgagatggtgctttctcagctattgcctatggctgaacaa
ctgctagaaaagatccagaaggagcccacagctgtgctgaaagatgaggccatggttctg
catctcactctgggaaagtataatgaattttcagtttcccttttaaatgaggatccgaag
agtctagatatatttataaaagctgtgcacacaacaaaggaactttacgcgggaatgcca
accattcagatcacagcccttgaaaagattacaaaaccattttttgcagccatatcagat
gaaaaagttcagcagaagcttttaagaatgttgtttgatttattggtgaactgtaaaaac
tcacattgtgctcagactgtcagcagtgtttttaaagggatttccgttaatgctgaacaa
gtccgaatagaactggagccaccagataaagctaaacccttgggcacagttcagcaaaaa
agaaggcaaaaaatgcagcagaaaaaatcacaagatctagaatctgttcaggaagttgga
ggttcttactggcaaagagtaactctcatcctggaattactgcagcacaaaaagaagctc
agaagtcctcagatattggtgccaactctttttaacttgctatcaagatgtttagaaccc
ttgccacaagagcagggaaatatggaatacaccaaacaattaattcttagttgtctgctc
aacatctgccaaaaactatctccagatggtggcaaaatacccaaagatattttagatgag
gagaagttcaacgtggagttgatagttcagtgcatccgcctttcggagatgccgcagacc
catcaccatgcccttttacttttgggcactgttgctggaatatttccggataaagtttta
cacaatatcatgtctatttttacatttatgggagccaatgtcatgcgcctagatgatact
tacagttttcaagttattaacaagacagtgaaaatggttattcccgcacttattcagtct
gatagtggagattctatagaagtttcaagaaacgttgaagagattgtggtaaaaatcatt
agtgtatttgtggatgcgctgccacacgtcccggagcacaggcgcctgcccatccttgtt
caacttgttgatacactgggtgcagagaaattcctctggattctcctcatcttgcttttt
gaacagtatgtcacaaaaacagtgctggcggctgcctatggcgaaaaggatgctatttta
gaagcagacactgaattttggttttcagtctgttgtgagtttagtgtccagcatcagata
caaagcttgatgaatatcctccagtacttactaaagctgccagaggaaaaagaagaaacc
attcccaaagcagtgtcatttaataagagtgaatcacaagaagaaatgctacaggttttt
aatgtagagactcacactagcaagcaactgcggcattttaaatttttgtcagtgtccttc
atgtctcagctcctgtcttccaataattttctgaaaaaggtagttgagagtggtggtcct
gagattttaaaaggccttgaagagaggttgctggagaccgttctcggctatatcagtgca
gttgcacagtccatggaaaggaacgcagacaaactcaccgtgaagttctggcgcgcgctc
cttagtaaagcttacgacctgttagataaggtcaatgccttgctgcccacagagacattc
attcctgtgatcagagggctggtgggcaatcccctgccatctgttcgccgcaaagcgctg
gaccttttgaataacaagctgcagcaaaatatatcctggaagaagacaatagttacccgt
ttcctaaaactggttccagaccttttggccattgtgcagcgtaagaaaaaggaaggggaa
gaagaacaagcaatcaacagacagacagcgttgtataccttaaagcttttatgcaagaat
tttggtgcagaaaatccagatccttttgtcccagtgctgaacactgctgtgaaactgatt
gctccagagagaaaggaggagaagaatgtcctgggaagcgcgctgctgtgcatagcagag
gtgacctccaccctggaggcgctggccatcccccagcttcccagcctgatgccatcgttg
ctgacaacaatgaagaacaccagcgagctggtctccagcgaggtctacctgctcagtgcc
ttggctgctctgcagaaggttgtggagactctcccgcacttcatcagcccctatctggaa
ggcattctctcccaggtgattcatctggagaaaatcactagtgaaatgggttctgcgtca
caggctaatatccgtctcacatctcttaaaaagacactggctaccacacttgcaccccga
gtcctgttgcccgccatcaaaaaaacttacaagcagattgagaagaactggaagaatcac
atgggtccgtttatgagcatcttgcaagagcatattggggtgatgaagaaggaagagctc
acctcccatcagtctcagctaaccgcctttttcctggaagccctggacttccgagcccag
cactctgagaacgatctggaggaagttggaaaaacggaaaattgtatcattgactgtcta
gtagccatggttgtcaaactttccgaggtcacattcaggcccctgttcttcaagctgttt
gattgggctaaaacagaagatgccccaaaggacaggttgttgacattttacaacttggca
gattgcattgctgaaaagctgaaagggctttttactctgtttgccggccacttagtgaag
ccttttgctgacaccttgaaccaggtgaacatctccaaaacagatgaagcattttttgac
tctgaaaatgaccctgaaaagtgctgcttgctgttgcagtttattttgaactgtttatac
aaaatcttcctttttgatacccagcattttataagtaaagagagagcagaagccttgatg
atgcctctggtggatcagctggaaaacaggcttgggggagaagagaaattccaggaacgg
gtgacaaagcacctgataccatgcatcgcacagttttcggtggccatggcggatgactct
ctttggaaaccactgaactaccagattctgctaaagacgagagactcctcgcctaaggtt
cgatttgctgctttgattactgtgttagcactggctgaaaaactaaaggagaattatatt
gtcttgctaccagaatccattcctttcttagcagagttgatggaagatgaatgtgaagaa
gtagaacatcagtgccaaaagactattcagcaactggaaactgtcctgggagagccactc
cagagctatttctaa

DBGET integrated database retrieval system