KEGG   Homo sapiens (human): 55131Help
Entry
55131             CDS       T01001                                 

Gene name
RBM28
Definition
RNA binding motif protein 28
Orthology
K14573  
nucleolar protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00621  
Alopecia neurologic defects and endocrinopathy syndrome (ANE syndrome)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55131 (RBM28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q32.1
AA seq 618 aa AA seqDB search
MAGLTLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGRTVAVDWAVAKDKYKDTQSV
SAIGEEKSHESKHQESVKKKGREEEDMEEEENDDDDDDDDEEDGVFDDEDEEEENIESKV
TKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSN
KKKRKLPSDVNEGKTVFIRNLSFDSEEEELGELLQQFGELKYVRIVLHPDTEHSKGCAFA
QFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVTRDEAAKLQTTKVKKPTGTRNLY
LAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQNIFVSRTRLCLHNLPKAVDDK
QLRKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLIN
NNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQ
KAAQHHTEEQSKVPPEQKRKAGSTSWTGFQTKAEVEQVELPDGKKRRKVLALPSHRGPKI
RLRDKGKVKPVHPKKPKPQINQWKQEKQQLSSEQVSRKKAKGNKTETRFNQLVEQYKQKL
LGPSKGAPLAKRSKWFDS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctgaccttatttgtgggccgcctcccgccctcggcccgcagtgagcagctg
gaggaactgttcagtcaggtggggccggtgaagcagtgcttcgtggtgactgaaaaaggc
cggacagtggctgtggattgggccgtggcaaaggataaatataaagatacacagtctgtt
tctgctataggtgaggaaaagagccatgaatctaaacatcaggaatcagttaaaaagaag
ggcagagaggaagaggatatggaagaggaagaaaacgatgatgatgacgatgatgatgat
gaagaagatggggtttttgatgatgaagatgaagaggaagagaatatagaatcaaaggtg
accaagcctgtgcaaattcagaagagagcagtcaagagaccagcccctgcaaaaagcagt
gatcattctgaggaggacagtgacctagaggaaagcgatagtattgatgatggagaggaa
ctggctcagagtgataccagcactgaggagcaagaggataaagctgtgcaagtctcaaac
aaaaagaagaggaaattaccctctgatgtgaatgaagggaaaactgtttttatcagaaat
ctgtcctttgactcagaagaagaagaacttggggagcttctccaacagtttggagaactc
aaatatgtccgcattgtcttgcatccagacacagagcattctaaaggttgtgcatttgcc
cagttcatgactcaagaagcagctcagaaatgccttctagctgcttctccagagaatgag
gctggtgggcttaaactggatggccggcagctcaaggttgacttggcggtgacccgtgat
gaggctgcaaagcttcagacgacgaaggtgaagaagccgactggcacccggaatctctat
ctggcccgagaaggcttgattcgtgctgggacgaaggctgcagagggtgtgagtgctgct
gatatggccaaaagagaacggtttgagctgctgaagcatcagaaactcaaggaccagaat
atctttgtctcccgaaccaggctctgcctgcacaatctcccaaaggctgtagatgacaaa
cagctcagaaagctgctgctgagtgctactagtggagagaaaggggtgcgcatcaaggag
tgtagagtgatgcgagacctcaaaggagttcatgggaacatgaagggtcagtccctgggc
tacgcctttgcggagttccaagagcacgagcatgccctgaaagccctccgcctcatcaac
aacaatccagaaatctttgggcctctgaagagaccaatagtggagttctctttagaagat
cgaagaaaacttaaaatgaaggaattaaggatccagcgcagcttgcaaaaaatgagatcc
aagcctgcaactggtgagcctcagaaggggcaaccagagcctgcaaaagaccagcaacag
aaggcagctcaacaccacacagaggaacaaagcaaggtgcccccagagcagaagagaaag
gcgggctctacctcatggaccgggttccagaccaaggctgaagtggagcaggtggagctg
cctgatggaaagaagagaagaaaggtcctggcgctcccctcacaccgaggccccaaaatc
aggttgcgggacaaaggcaaagtgaagcccgtccatcccaaaaagccaaagccacagata
aaccagtggaagcaggagaagcagcaattatcgtccgagcaggtatctaggaaaaaagct
aagggaaataagacggaaacccgcttcaaccagctggtcgaacaatataagcagaaatta
ttgggaccttctaaaggagcacctcttgcaaagaggagcaaatggtttgatagttga

DBGET integrated database retrieval system