KEGG   Homo sapiens (human): 55140Help
Entry
55140             CDS       T01001                                 

Gene name
ELP3, KAT9
Definition
(RefSeq) elongator acetyltransferase complex subunit 3 (EC:2.3.1.48)
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     55140 (ELP3)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    55140 (ELP3)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    55140 (ELP3)
   HAT complexes
    Elongator complex
     55140 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.1
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKMLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcggaaaggagatctcagccctgctgagctgatgatgctgactatagga
gatgttattaaacaactgattgaagcccacgagcaggggaaagacatcgatctaaataag
gtgaaaaccaagacagctgccaaatatggcctttctgcccagccccgcctggtggatatc
attgctgccgtccctcctcagtatcgcaaggtcttgatgcccaagttaaaggcgaaaccc
atcagaactgctagtgggattgctgtcgtggctgtgatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtatactgccctggtggacctgattctgatttt
gagtattccacccagtcttacactggctatgagccaacctccatgagagctatccgtgcc
agatatgaccctttcctacagacaagacaccgaatagaacagttaaaacaacttggtcat
agtgtggataaagtggagtttattgtgatgggtggaacgtttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacttccaacaat
atttacgaggcagtcaagtattctgagagaagcctcacaaagtgtattggaattactatt
gaaaccagaccagattactgcatgaagcgacatttaagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtttatgaagatgtggctagagacaccaacagg
ggccacactgtgaaggcagtgtgtgagtcatttcacctggccaaagattccggttttaaa
gtggtggcccatatgatgcctgacctgccaaacgtgggactagaaagagacattgaacag
ttcacagagttttttgagaaccctgcttttcgtcccgatgggctgaaactctatcctacc
ctggtgattcgtgggaccgggctttatgagctttggaaatcaggaagatataagagttac
tctcctagtgacctggttgaattggtggctcggatcctagccctcgtgcctccatggact
cgagtgtaccgagtacagagggatattccaatgcctttagttagctcaggagtagagcat
ggtaacctgagagagctggcacttgcaagaatgaaagacctcggaatacagtgtcgagat
gtgagaaccagagaagttggaatccaagaaattcatcacaaagtacggccataccaggtt
gaattggtaaggagagattatgttgcaaatggtggctgggaaacattcttgtcatacgaa
gacccagatcaagacattttgattggcctcctacgattacgcaagtgttcagaagaaact
ttccgtttcgaattgggtggaggtgtctccatagtacgagagctgcatgtgtatgggagt
gtggtccctgtgagcagccgggatcctactaaatttcagcatcagggatttggcatgctg
ctgatggaggaagcagaaagaatagctagagaagaacatgggtctgggaaaatcgctgtg
atatcaggggtcggcaccaggaattattatagaaagatcggctacagattacaaggcccg
tacatggtgaagatgctgaaataa

DBGET integrated database retrieval system