KEGG   Homo sapiens (human): 55143Help
Entry
55143             CDS       T01001                                 

Gene name
CDCA8, BOR, BOREALIN, DasraB, MESRGP
Definition
(RefSeq) cell division cycle associated 8
  KO
K11514  
Borealin
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     55143 (CDCA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.3
AA seq 280 aa AA seqDB search
MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILR
LPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVD
EMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVS
MVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLR
LLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaggaagggcagtagtcgggtggccaagaccaactccttacggaggcggaag
ctcgcctcctttctgaaagacttcgaccgtgaagtggaaatacgaatcaagcaaattgag
tcagacaggcagaacctcctcaaggaggtggataacctctacaacatcgagatcctgcgg
ctccccaaggctctgcgcgagatgaactggcttgactacttcgcccttggaggaaacaaa
caggccctggaagaggcggcaacagctgacctggatatcaccgaaataaacaaactaaca
gcagaagctattcagacacccctgaaatctgccaaaacacgaaaggtaatacaggtagat
gaaatgatagtggaagaggaagaagaagaagaaaatgaacgtaagaatcttcaaactgca
agagtcaaaaggtgtcctccatccaagaagagaactcagtccatacaaggaaaaggaaaa
gggaaaaggtcaagccgtgctaacactgttaccccagccgtgggccgattggaggtgtcc
atggtcaaaccaactccaggcctgacacccaggtttgactcaagggtcttcaagacccct
ggcctgcgtactccagcagcaggagagcggatttacaacatctcagggaatggcagccct
cttgctgacagcaaagagatcttcctcactgtgccagtgggcggcggagagagcctgcga
ttattggccagtgacttgcagaggcacagtattgcccagctggatccagaggccttggga
aacattaagaagctctccaaccgtctcgcccaaatctgcagcagcatacggacccacaaa
tga

DBGET integrated database retrieval system