KEGG   Homo sapiens (human): 55157Help
Entry
55157             CDS       T01001                                 

Gene name
DARS2, ASPRS, LBSL, MT-ASPRS
Definition
aspartyl-tRNA synthetase 2, mitochondrial (EC:6.1.1.12)
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H00871  
Leukoencephalopathy with brain stem and spinal cord involvement and lactate elevation (LBSL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    55157 (DARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     55157 (DARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   55157 (DARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    55157 (DARS2)
 Prokaryotic Type
   Other AARSs
    55157 (DARS2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    55157 (DARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25.1
AA seq 645 aa AA seqDB search
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSS
HLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSG
TVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRS
FQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLP
QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGL
LQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDAL
SKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLW
VVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGS
IRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRD
VIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcccttcttggttaagtcagctgtacaggggtttatccagacccatcagaagg
accacccaaccgatctggggttctctctacagaagtctgttgcagagttcacagaggaga
attccagaattcagtagctttgttgtccggaccaacacatgtggagagttgcgttcgtct
cacttaggccaagaagtcaccttgtgtggatggattcagtaccgaaggcaaaacacattc
ttggtcctaagagatttcgatgggcttgttcaagttatcattccccaggatgagtcggca
gcctctgtgaagaagattttatgtgaagcccctgtggaatctgtggtgcaagtgtctggt
acagtcatttcccgtcctgcaggacaagagaatccaaaaatgccaacaggtgagattgaa
atcaaagttaaaacagctgagcttctgaatgcctgcaagaagctgccctttgaaattaag
aacttcgtgaagaaaacagaggctcttcggttgcagtatcgctacttagacttgcgtagt
ttccaaatgcagtataacctgcgactgaggtcccagatggtcatgaaaatgcgggaatat
ctctgtaatctgcatgggtttgtggatatagaaacccccacattgtttaagaggacccca
gggggtgccaaagagtttttagtaccatccagggaacctggaaagttttattctctccct
cagagtcctcaacagtttaagcaacttctgatggttggcggtttagacagatattttcag
gttgcccgatgttatcgagatgaaggttcaagaccagacagacagcctgagtttactcag
attgacatagagatgtcatttgtagaccagactgggatccagagtttaattgagggtttg
ctccagtattcctggcccaatgacaaagatcctgtggttgttccttttcctactatgact
tttgctgaggtgctggccacctatggaactgataaacctgacactcgctttggaatgaag
attatagatatcagtgatgtgtttagaaacacagagattggatttcttcaagatgcactt
agtaagccccatggaactgtgaaagccatatgtatccctgaaggagcaaaatacttaaaa
aggaaagacattgaatccattagaaactttgcagctgaccattttaatcaggaaatctta
cctgtattccttaacgccaatagaaactggaattctccagttgctaatttcataatggag
tcacaaagactggaattaatcagactaatggagacccaagaggaagatgtggtcctacta
actgctggagagcacaataaagcatgctctttgttaggaaaattacgactggaatgtgct
gaccttctagaaacaagaggagtggtgctccgtgaccccactctgttctctttcctttgg
gtggtagatttcccactcttcctgcccaaggaggaaaatcccagagagctggaatcggcc
caccacccatttactgctccccaccccagtgacatacatctcctgtacactgagcccaaa
aaggcccgtagccaacactatgacttggttttaaatggcaatgaaataggaggtggttca
attcgaattcacaatgcagagctgcagcgttatatcctggcaaccttactaaaggaggat
gtgaaaatgctctcccatctgctccaggctttagattatggggcaccccctcatggagga
attgccttagggttagacagactgatatgccttgtcactggatctccaagcatcagagat
gtcatagccttcccaaagtccttccggggacatgacctcatgagcaataccccagattct
gtccctcctgaggaactgaagccctatcatatccgagtctccaagccaacagactccaaa
gcagaaagagctcattga

DBGET integrated database retrieval system