KEGG   Homo sapiens (human): 55163Help
Entry
55163             CDS       T01001                                 

Gene name
PNPO, HEL-S-302, PDXPO
Definition
(RefSeq) pyridoxamine 5'-phosphate oxidase
  KO
K00275  
pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin B6 metabolism
Metabolic pathways
Disease
H01124  
Pyridox(am)ine-5'-phosphate oxidase (PNPO) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    55163 (PNPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     55163 (PNPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NVS9(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 261 aa AA seqDB search
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVK
QFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKE
LDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPD
REYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGD
SPLGPMTHRGEEDWLYERLAP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgctggctgcggggcgtcacggcgacgttcgggcgacctgccgagtggccaggc
tacctcagtcacctgtgtggtcgcagtgctgccatggacctgggacccatgcgcaagagt
taccgcggggaccgagaggcatttgaggagactcatctgacctcccttgacccagtgaaa
cagtttgctgcctggtttgaggaggctgttcagtgtcctgacataggggaagccaatgcc
atgtgtctggctacctgcaccagagatggaaaaccctctgctcgcatgttgctgctgaag
ggcttcgggaaagatggcttccgcttcttcactaacttcgagagtcgaaaaggaaaagag
ctggactctaatccctttgcttcccttgtcttctactgggagccacttaaccgtcaggtg
cgtgtggaaggccctgtgaagaaactgcctgaggaggaggctgagtgctacttccactcc
cgccccaagagcagccagattggggctgtggtcagccaccagagttctgtgatccctgat
cgggagtatctgagaaagaaaaatgaggaactggaacagctctaccaggatcaagaggtg
cccaagccaaaatcctggggtggctatgtcctgtaccctcaggtgatggagttctggcaa
ggtcaaaccaaccgcctgcatgaccggatagtctttcggcggggcctacccacaggagat
tcccctttggggcccatgacccaccgcggggaggaagactggctctatgagagacttgca
ccttaa

DBGET integrated database retrieval system