KEGG   Homo sapiens (human): 55176Help
Entry
55176             CDS       T01001                                 

Gene name
SEC61A2
Definition
(RefSeq) Sec61 translocon alpha 2 subunit
  KO
K10956  
protein transport protein SEC61 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Phagosome
Vibrio cholerae infection
Module
Sec61 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    55176 (SEC61A2)
   04141 Protein processing in endoplasmic reticulum
    55176 (SEC61A2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    55176 (SEC61A2)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    55176 (SEC61A2)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   55176 (SEC61A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H9S3(Tdark)
UniProt: 
Position
10p14
AA seq 476 aa AA seqDB search
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcaaatttttagaagttatcaaaccattctgtgcagttctaccagaaattcag
aaaccggaaaggaaaatccagtttagagagaaggttctgtggactgctataacgctcttc
attttcttagtgtgttgtcagatcccactgtttggaatcatgtcatcagattctgcagat
cctttctactggatgagagttattctggcttccaatagaggaactttaatggaattgggt
atctccccaattgtaacatctggtttgattatgcagttgttagctggagccaaaatcatt
gaagttggagatacaccgaaagatagagctttattcaatggagcccagaaactgtttggt
atgatcattaccattgggcaagccattgtgtatgtcatgacggggatgtatggggaccct
gcagaaatgggtgccggaatctgtctcctgatcatcattcagttgtttgttgctggtttg
attgtgctgctgttagatgagctgctacagaagggttacggcttggggtctgggatttcc
ctctttattgccaccaacatctgtgagaccattgtctggaaggcctttagtcccactacc
attaacactggcagaggtactgagtttgagggtgcagtcatagctctgttccatttgttg
gccaccaggacggacaaagtccgagctttacgggaggctttttatcggcagaacttaccc
aatctcatgaacctcattgctacagtttttgtgtttgctgttgttatatatttccaagga
tttcgcgttgatctgcccattaagtcggcccgttaccgaggacagtacagcagctacccc
atcaaactcttctacacctccaacatccccatcatcctccagtcggccctggtgtccaac
ctgtatgttatttcccagatgctgtctgttcgatttagtggcaactttttagtaaattta
ctaggacagtgggccgatgtcagtgggggaggacccgcacgttcttacccagttggaggc
ctttgttactatctttctcctcctgagtccatgggcgccatctttgaggatcctgtccat
gtcgttgtttatatcatcttcatgttggggtcatgtgcattcttctctaagacatggatt
gaagtgtctggttcctcagccaaagatgtagctaaacagctgaaagaacagcagatggta
atgaggggccaccgagatacctctatggttcatgagcttaataggtacatccccaccgca
gctgcgtttggcggtttgtgcattggcgccctgtcagtgctggctgacttcctgggggcc
attggatctggcactggaattctgctagcagtcactattatttaccagtattttgaaata
tttgttaaagaacaggccgaagttggtgggatgggtgctttgtttttctaa

DBGET integrated database retrieval system